KEGG   Escherichia coli K-12 MG1655: b2201Help
Entry
b2201             CDS       T00007                                 

Gene name
ccmA
Definition
(RefSeq) heme trafficking system ATP-binding protein
  KO
K02193  heme exporter protein A [EC:7.6.2.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b2201 (ccmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2201 (ccmA)
Enzymes [BR:eco01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     b2201 (ccmA)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Heme transporter
    b2201 (ccmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N DUF3584 AAA_30 AAA_29 AAA_23 AAA_28 AAA_13 cobW AAA_16 RsgA_GTPase MMR_HSR1 AAA_18
Motif
Other DBs
NCBI-GeneID: 946714
NCBI-ProteinID: NP_416705
Pasteur: ccmA
RegulonDB: ECK120001971
ECOCYC: EG12059
ASAP: ABE-0007279
UniProt: P33931
LinkDB All DBs
Position
complement(2297021..2297644)
Genome map
AA seq 207 aa AA seqDB search
MGMLEARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEV
LWQGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAG
FEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGI
VILTTHQPLNVAESKIRRISLTQTRAA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgggtatgcttgaagccagagagttactttgtgagcgggatgaacgaaccttatttagt
ggcttgtcatttacgctgaacgcaggagagtgggtacaaatcaccggtagcaacggcgcg
gggaagacaacgcttctccgtttgctgacggggttgtctcgccctgacgcaggcgaggtt
ctctggcaagggcagcccttgcatcaggtacgcgacagctaccatcaaaacctgttatgg
ataggccatcagccggggatcaaaacccggctgacggcgttagaaaatctgcacttttat
catcgcgatggcgataccgcacaatgtctggaagccctggcgcaggccgggcttgccgga
ttcgaagatattcctgtaaatcagctctcggccgggcaacaacgccgcgtcgctttagcg
cgtctgtggctgacccgtgccacgttatggatcctcgacgagccttttaccgcgattgac
gttaacggtgtcgatcgtctgacccagcgtatggcgcagcatacggagcagggggggatt
gtgattctgactacccaccagccgctcaacgttgctgaaagtaaaattcgccgcatttca
ctgacgcaaacgagggccgcatga

DBGET integrated database retrieval system