KEGG   Escherichia coli K-12 MG1655: b2559
Entry
b2559             CDS       T00007                                 

Symbol
tadA
Name
(RefSeq) tRNA adenosine(34) deaminase
  KO
K11991  tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b2559 (tadA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     b2559 (tadA)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic type
  tRNA modification factors
   Deaminases
    b2559 (tadA)
SSDB
Motif
Pfam: MafB19-deam dCMP_cyt_deam_1 Bd3614-deam SNAD4 APOBEC_N NAD1 NAD2 APOBEC2
Other DBs
NCBI-GeneID: 947027
NCBI-ProteinID: NP_417054
Pasteur: yfhC
RegulonDB: ECK120001340
ECOCYC: EG11372
ASAP: ABE-0008419
UniProt: P68398
Structure
LinkDB
Position
complement(2697354..2697857)
AA seq 167 aa
MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEI
MALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD
NT seq 504 nt   +upstreamnt  +downstreamnt
ttgtctgaagtcgaatttagccacgaatactggatgcgtcacgcgctgacgctggcgaaa
cgtgcctgggatgagcgggaagtgccggtcggcgcggtattagtgcataacaatcgggta
atcggcgaaggctggaaccgcccgattggtcgccatgatcccaccgcacatgcagaaatc
atggccctgcggcagggtggtctggtgatgcaaaattatcgtctgatcgacgccacgttg
tatgtcacgcttgaaccatgtgtaatgtgtgccggagcgatgatccacagtcgcattggt
cgcgtggtctttggtgcgcgtgacgcgaaaactggcgctgcgggatctttaatggatgtg
ctgcatcatccgggtatgaatcaccgagtggaaattacggaaggaatactggcggatgag
tgcgcggcgttgctcagtgacttctttcgcatgcgccgccaggaaattaaagcgcagaaa
aaagcgcaatcctcgacggattaa

DBGET integrated database retrieval system