KEGG   Escherichia coli K-12 MG1655: b4106Help
Entry
b4106             CDS       T00007                                 

Gene name
phnC
Definition
(RefSeq) phosphonate ABC transporter ATP binding subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4106 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4106 (phnC)
Enzymes [BR:eco01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     b4106 (phnC)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    b4106 (phnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 RsgA_GTPase SMC_N AAA_23 AAA_30 AAA_22 MMR_HSR1 Mg_chelatase AAA_25 AAA_5 NACHT AAA_18 AAA_33 AAA_28 SbcCD_C AAA_7 PhoH PRK Rad17 AAA_19 AAA_24 G-alpha TsaE cobW RNA_helicase
Motif
Other DBs
NCBI-GeneID: 948623
NCBI-ProteinID: NP_418530
Pasteur: phnC
RegulonDB: ECK120000705
ECOCYC: EG10713
ASAP: ABE-0013444
UniProt: P16677
LinkDB All DBs
Position
complement(4324377..4325165)
Genome map
AA seq 262 aa AA seqDB search
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSV
GSHIELLGRTVQREGRLARDIRKSRAHTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRVEENAKAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgattatccgtgtcgagaagctcgccaaaaccttcaatcagcatcaggcgctg
catgcggttgatctgaacattcatcacggtgaaatggtggctctgcttgggccgtcgggt
tccggaaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatctgtc
ggtagccatatcgagctgctgggccgcacagtccagcgcgaaggccgcctggcccgcgat
atccgcaaaagccgcgcccataccggctacatattccaacaattcaacctggtgaaccgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagctggttcaccggcgagcagaaacagcgcgcgttacaggcgctgacccgcgtt
ggcatggtgcattttgcccatcagcgcgtttccaccctctccggcggccagcagcaacgt
gtggcgattgcccgtgcgctgatgcagcaggcgaaagtgattctggccgatgaacccatc
gcctcgctggacccagaatcagcgcgcatcgtgatggacaccctgcgcgacatcaaccag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgtcttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcattaaccgcgtcgaagagaacgcgaaa
gctgcctga

DBGET integrated database retrieval system