KEGG   Escherichia coli K-12 MG1655: b4177Help
Entry
b4177             CDS       T00007                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco00250  Alanine, aspartate and glutamate metabolism
eco01100  Metabolic pathways
Module
eco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b4177 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b4177 (purA)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     b4177 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 948695
NCBI-ProteinID: NP_418598
Pasteur: purA
RegulonDB: ECK120000781
ECOCYC: EG10790
ASAP: ABE-0013672
UniProt: P0A7D4
LinkDB All DBs
Structure
PDB: 

Position
4404687..4405985
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggtaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
ctccgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccggccgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcatgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccggtcgtggtatcgggcctgcttatgaagat
aaagtagcacgtcgcggtctgcgtgttggcgaccttttcgacaaagaaaccttcgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagctgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggtggttgacgtttctgacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtacgctgctggatatcgaccacggtacttatccgtacgtaact
tcttccaacaccactgctggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgtgtaggtgcaggtccgttcccg
accgaactgtttgatgaaactggcgagttcctctgcaagcagggtaacgaattcggcgca
actacggggcgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgactaaactggacgttctggatggcctgaaa
gaggttaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggcctgccgcaggcggcgctgaactatatc
aagcgtattgaagagctgactggtgtgccgatcgatatcatctctaccggtccggatcgt
actgaaaccatgattctgcgcgacccgttcgacgcgtaa

DBGET integrated database retrieval system