KEGG   Escherichia coli APEC O78: APECO78_20915Help
Entry
APECO78_20915     CDS       T02445                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecoa  Escherichia coli APEC O78
Pathway
ecoa00564  Glycerophospholipid metabolism
ecoa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APECO78_20915
Enzymes [BR:ecoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     APECO78_20915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AGC88900
LinkDB All DBs
Structure
PDB: 

Position
4323428..4324933
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggctccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
actggtttgcgttttggcgcaaattcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaggcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaattacctgctgaaagtgtataacacgcacttt
aaaaagcagttaagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagttgaccacctaccgcaaa
ctggcggaacatgcgctggaaaaactgacgccgtattatcagggcattggcccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgcgacgattatgccgct
cgcctgcgccgccgctatccgttcctgactgaatcgctggcgcgtcattacgctcgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggaacggtaagcgatctcggggaa
gatttcggtcatgagttctacgaagcggagctgaaatacctggtggatcacgaatgggtc
cgccgcgccgacgacgccctgtggcgtcgcacaaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctggtggagtatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system