KEGG   Escherichia coli APEC O78: APECO78_21455Help
Entry
APECO78_21455     CDS       T02445                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ecoa  Escherichia coli APEC O78
Pathway
ecoa00500  Starch and sucrose metabolism
ecoa01100  Metabolic pathways
ecoa02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APECO78_21455 (bcsA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    APECO78_21455 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecoa01003]
    APECO78_21455 (bcsA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecoa02000]
    APECO78_21455 (bcsA)
Enzymes [BR:ecoa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     APECO78_21455 (bcsA)
Glycosyltransferases [BR:ecoa01003]
 Polysaccharide
  Structural polysaccharide
   APECO78_21455 (bcsA)
Transporters [BR:ecoa02000]
 Other Transporters
  Others
   APECO78_21455 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: AGC89008
LinkDB All DBs
Position
complement(4447715..4450333)
Genome map
AA seq 872 aa AA seqDB search
MSILTRWLLIPPVNARLIGRYRDYRRHGASAFSATLGCFWMILAWIFIPLEHPRWQRIRA
EHKNLYPHINASRPRPLDPVRYLIQTCWLLIGTSRKETPKPRRRAFSGLQNIRGRYHQWM
NELPERVSHKTQHLDEKKELGHLSAGARRLILGIIVTFSLILALICVTQPFNPLAQFIFL
MLLWGVALIVRRMPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLILLFAE
TYAWIVLVLGYFQVVWPLNRQPVPLPKDMSLWPSVDIFVPTYNEDLNVVKNTIYASLGID
WPKDKLNIWILDDGGREEFRQFAQNVGVKYIARTTHEHAKAGNINNALKYAKGEFVSIFD
CDHVPTRSFLQMTMGWFLKEKQLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLTGKGLKFAQRLCYVNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVLPHMIHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTLVALINPHKGKFNVTAKGGLVEEEYVDWVISRPYIFLVLLNLVGVAVGIWRYFYG
PPTEMLTVVVSMVWVFYNLIVLGGAVAVSVESKQVRRSHRVEMTMPAAIAREDGHLFSCT
VQDFSDGGLGIKINGQAQILEGQKVNLLLKRGQQEYVFPTQVARVMGNEVGLKLMPLTTQ
QHIDFVQCTFARADTWALWQDSYPEDKPLESLLDILKLGFRGYRHLAEFAPSSVKGIFRV
LTSLVSWVVSFIPRRPERSETAQPSDQALAQQ
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctgacccggtggttgcttatcccgccggtcaacgcgcggcttatcgggcgt
tatcgcgattatcgtcgtcacggtgcgtcggctttcagcgcgacgctcggctgtttctgg
atgatcctggcctggatttttattccgctggagcacccgcgctggcagcgtattcgcgca
gaacataaaaacctgtatccgcatatcaacgcctcgcgtccgcgtccgctggacccggtc
cgttatctcattcaaacatgctggttactgatcggtacatcgcgcaaagaaacgccgaaa
ccgcgcaggcgggcattttcaggtctgcagaatattcgtggacgttaccatcaatggatg
aacgagctgcctgagcgcgttagccataaaacacagcatcttgatgagaaaaaagagctc
ggtcatttgagtgccggggcgcggcggttgatcctcggtatcatcgtcaccttctcgctg
attctggcgttaatctgcgttactcaaccgtttaacccgctggcgcagtttatcttcctg
atgctgctgtggggtgtagcgctgatcgtacggcggatgccggggcgcttctcggcgcta
atgttgattgtgctgtcgctgaccgtttcttgccgttatatctggtggcgttacacctct
acgctgaactgggacgatccggtcagcctggtgtgcgggcttattctgctcttcgctgaa
acgtacgcgtggattgtgctggtgctcggctacttccaggtagtatggccgctgaatcgt
cagccggtgccattgccgaaagatatgtcgctgtggccgtcggtggatatctttgtcccg
acttacaacgaagatctcaacgtggtgaaaaatactatttacgcctcgctgggtatcgac
tggccgaaagacaagctgaacatctggatcctcgatgacggcggtagggaagagtttcgc
cagtttgcgcaaaacgtgggggtgaaatatatcgcccgtaccactcatgaacatgcgaaa
gcgggcaacatcaacaatgcgctgaaatatgccaaaggcgagttcgtgtcgattttcgac
tgcgaccacgtaccaacgcgatcgttcctgcaaatgaccatgggctggttcctgaaagag
aaacagctggcgatgatgcagactccacaccacttcttctcgccggacccgtttgaacgc
aacctggggcgtttccgtaaaacaccgaacgaaggcacgctgttctatggtctggtgcag
gatggcaacgatatgtgggacgccactttcttctgcggttcctgtgcagtaattcgtcgc
aaaccattggatgaaattggcggtattgctgtcgaaacggtaaccgaagatgcgcacacg
tctctgcgcctgcaccgtcgtggctacacctctgcatatatgcgtattccgcaggcggcg
gggctggcgaccgaaagtctgtcggcgcatatcggtcagcgtattcgctgggcacgcggg
atggtgcaaatcttccgtctcgataacccgcttaccggtaaagggctgaaattcgcccag
cggctgtgctacgtcaacgccatgttccacttcttgtcgggcattccacgactgatcttc
ctgactgcgccgctggcgttcctgctgcttcatgcctacatcatctatgcgccagcgttg
atgatcgccctgttcgtgctgccgcatatgatccatgccagcctgaccaactcgaagatc
cagggcaaatatcgccactctttctggagtgaaatctacgaaacggtgctggcgtggtat
atcgcaccaccgacgctggtggcgctgattaacccgcacaaaggcaaatttaacgtcacc
gccaaaggtggactggtggaagaagagtacgtcgactgggtgatctcgcggccctacatc
ttccttgttctactcaacctggtgggcgttgcggtaggcatctggcgctacttctatggc
ccgccaaccgagatgctcaccgtggtcgtcagtatggtgtgggtgttctacaacctgatt
gttcttggcggcgcagttgcggtatcggtagaaagcaaacaggtacgccgatcgcaccgc
gtggagatgacgatgcccgcggcaattgcccgcgaagatggtcacctcttctcgtgtacc
gttcaggatttctccgacggtggtttggggatcaagatcaacggtcaggcgcagattctg
gaagggcagaaagtgaatctgttgcttaaacgcggtcagcaggaatacgtcttcccgacc
caggtggcgcgcgtgatgggtaatgaagttgggctgaaattaatgccgctcaccacccag
caacatatcgattttgtgcagtgtacgtttgcccgtgcggatacatgggcgctctggcag
gacagctacccggaagataagccgctggaaagtctgctggatattctgaagctcggcttc
cgtggctaccgccatctggcggagtttgcgccttcttcggtgaagggcatattccgtgtg
ctgacttctctggtttcctgggttgtatcgtttattccgcgccgcccggagcggagcgaa
acggcacaaccatcggatcaggctttggctcaacaatga

DBGET integrated database retrieval system