KEGG   Emcibacter congregatus: FIV45_09520Help
Entry
FIV45_09520       CDS       T06024                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ecog  Emcibacter congregatus
Pathway
ecog00970  Aminoacyl-tRNA biosynthesis
ecog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecog00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FIV45_09520 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecog03029]
    FIV45_09520 (gatB)
Enzymes [BR:ecog01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     FIV45_09520 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     FIV45_09520 (gatB)
Mitochondrial biogenesis [BR:ecog03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FIV45_09520 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: QDE27500
LinkDB All DBs
Position
complement(2104331..2105815)
Genome map
AA seq 494 aa AA seqDB search
MNKYVQGATGDWEVVIGLEIHAQVLSESKLFSGASTKFGGEPNTHVSFVCSAMPGMLPVI
NEECVRQAVRTGLAMGCQINLRSVFDRKNYFYADLPQGYQISQFKDPIVGEGELVVDLED
GSTKTIGVERLHLEQDAGKSMHDQHPSETYVDLNRSGVALMEIVSKPDMRSAEEAAAYFR
KIRTIVRYAGTCDGNMDQGSMRADVNVSVRRPGEEFGTRTETKNVNSIRFMIQVINYEVQ
RQIDILEEGGTIDQETRQFDPATGTTSGLRSKEEAHDYRYFPDPDLLPLEFSQEFVDDLA
RGLPELPDAKRLRLVKDLGISEYNAAVLVAEKENADYFEDLLEAFSQKTGKDKAELASQA
ANWVIVDLFGALKKAGKSITDSPVGTKDGAELLALQVDGTISGRIAKDVFEIMLESGKSP
EAIVEEKGLKQVSDTGAIEAMIDEVLSANQDKVEQYRGGKDKLFGFFVGQVMKKTQGKAN
PQVVNELLRPKLDG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatgtacagggcgccaccggggattgggaagtcgtgatcggtctggaaatt
catgcacaggttctgtctgaatcaaagctgttttccggcgcgtccaccaaatttggtggc
gagccgaatactcatgtaagtttcgtctgtagcgccatgcccggcatgctgccggtgatc
aacgaagaatgcgtacgtcaggccgtgcgcaccggtcttgccatggggtgccagatcaat
ctgcgctcggtctttgaccgtaagaattatttctacgccgatttgccgcagggctatcag
atttcccagttcaaggatccgattgtcggcgaaggtgagttggtggttgatctggaagac
ggctccaccaaaaccatcggtgtggagcgcctgcatctggaacaggatgcgggaaagtcc
atgcatgaccagcatccgtcagagacctatgttgacctgaaccggtccggcgtcgccctg
atggaaatcgtatccaagcctgatatgcgcagtgcggaagaggctgcggcctatttccgc
aagatccgcaccatcgttcgctatgcaggcacctgtgatggcaatatggatcaggggtcc
atgcgtgccgatgtcaatgtatctgtacgtcgtccgggagaagaatttggcacccggaca
gaaaccaagaacgtcaactcgatccgctttatgattcaggtgatcaactatgaagtccaa
cgtcagattgatattctggaagagggcgggacaattgatcaggaaacccgtcaattcgat
ccggccaccggcaccacaagcggcctgaggtccaaggaagaagcacatgattatcgttat
ttcccggatcccgatttactgccgttggaattcagtcaggaatttgttgatgatctggcg
cggggcttgcccgaattacccgacgccaagcgtttgcgtctggtgaaggatctgggtatt
tccgaatataatgccgcggttctggtggcggaaaaagagaatgctgactatttcgaagat
ttgctcgaggctttttcccagaaaacagggaaagacaaggcagagcttgctagtcaggcg
gccaactgggtgattgttgatctgttcggcgcgctgaagaaagccggaaaatccatcaca
gacagcccggtcggcactaaggatggggcagagctgctggcgttgcaggttgatggcacc
atttcaggtcgtatcgccaaggatgttttcgaaattatgctggaaagcggcaagagcccg
gaagcaatcgtggaagagaaggggctgaaacaggtatccgacaccggcgcgattgaggcg
atgattgatgaggtgctcagcgccaatcaggataaggtcgaacaataccgtggcgggaaa
gataaattatttggtttcttcgtcggccaggtgatgaaaaagacccagggcaaggccaac
ccgcaggtggtgaatgaactgctgcggccgaaactcgatggttga

DBGET integrated database retrieval system