KEGG   Emcibacter congregatus: FIV45_16345Help
Entry
FIV45_16345       CDS       T06024                                 

Definition
(GenBank) DUF1223 domain-containing protein
Organism
ecog  Emcibacter congregatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1223
Motif
Other DBs
NCBI-ProteinID: QDE28728
LinkDB All DBs
Position
complement(3706437..3707225)
Genome map
AA seq 262 aa AA seqDB search
MNIVLQMFRILSVFCIVTIFVGFASVLHAKPSSEAVIEAPLVVVELFTSQGCASCPPADA
ILTELSQQDDILALSYFVDYWNYLGWEDTFAGKDCTIRQKKYSRALGKSGVYTPQMIVQG
TSDIVGSRGKQIHEMVGSTRQKIALTAKDAPRITFDPMGDMIDLKVSAGKQSGSRPKNAT
IWIIGYDYEKSVDIKWGEQGGNVRHYRNVVQSIKRIGSWMGEEIKLTLSKKDIGAVPYDA
YAVILQEDETGPIVAAAKLTLK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttttacaaatgtttcgaattttatctgttttttgcattgtcacaattttt
gtcggctttgcaagtgtcttgcatgctaaaccctcctcagaggcggtgatagaagcgcct
ctggttgtggtggaactttttacttcccagggctgtgcttcctgcccgccggcggatgca
attctcacggaactcagtcagcaggatgacattctggccttaagctattttgtcgattac
tggaactatctcggctgggaagatacgtttgccggcaaggactgcaccatccgtcagaag
aaatatagccgcgctcttggcaagagcggggtttatacgccgcagatgatcgttcagggc
accagcgatatcgtggggtcccggggaaaacagatacatgaaatggtcggcagcacccgc
cagaaaatcgccctgacagcaaaggatgctccaaggattacgtttgaccctatgggagac
atgattgacctgaaggtcagtgcgggaaagcagtccggttcccgcccgaagaacgcgacc
atctggattatcggctatgattacgaaaagagtgtggatatcaaatggggtgaacagggc
ggtaatgtccgccactatcgtaacgttgtgcaatccattaaacgtatcggcagctggatg
ggggaagaaatcaaactgaccctgtcgaaaaaggatatcggcgcggtaccctatgatgca
tatgccgtgatcctgcaggaagacgaaacaggccccattgtcgccgcggcgaaattgacg
ttgaaatag

DBGET integrated database retrieval system