KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0361Help
Entry
ECRM13516_0361    CDS       T03011                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00730  Thiamine metabolism
ecoh00790  Folate biosynthesis
ecoh01100  Metabolic pathways
ecoh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECRM13516_0361 (phoA)
   00790 Folate biosynthesis
    ECRM13516_0361 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECRM13516_0361 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoh04147]
    ECRM13516_0361 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecoh00537]
    ECRM13516_0361 (phoA)
Enzymes [BR:ecoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECRM13516_0361 (phoA)
Exosome [BR:ecoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECRM13516_0361 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecoh00537]
 Enzymes
  ECRM13516_0361 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AHG13049
LinkDB All DBs
Structure
PDB: 

Position
385531..386988
Genome map
AA seq 485 aa AA seqDB search
MFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARR
LTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQY
THYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATG
NVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTL
GGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNM
PVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGA
SIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAP
GLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKA
ALGLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttattttttaatgtatttgtacatggagaaaataaagtgaaacaaagcactatt
gcactggcactcttaccgttactgtttacccctgtgacaaaagcccggacaccagaaatg
cctgttctggaaaaccgggctgctcagggcgatattactgcacccggcggtgctcgccgc
ttaacgggtgatcagaccgccgctctgcgtgattctcttagcgataaacctgcaaaaaat
attattttgctgattggcgatgggatgggggattcggaaattactgccgcacgtaattat
gccgaaggtgcgggcggcttttttaaaggtatcgatgccttaccgcttaccgggcaatac
actcactatgcgctgaataaaaaaaccggcaaaccggactacgtcaccgactcggctgca
tcagcaaccgcctggtcaaccggtgtcaaaacctataacggcgcgctgggcgtcgatatt
cacgaaaaagatcacccaacgattctggaaatggcaaaagccgcaggtctggcgaccggt
aacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgtgacc
tcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctggaa
aaaggcggaaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacgctt
ggcggcggcgcaaaaacctttgctgaaacggcaaccgctggtgaatggcagggaaaaacg
ctgcgtgaacaggcacaggcgcgtggttatcagttggtgagcgatgctgcctcactgaat
tcggtgacggaagcgaatcagcaaaaacccctgcttggcctgtttgctgacggcaatatg
ccagtgcgctggctaggaccgaaagcaacgtatcacggtaatattgataagcccgcagtc
acctgtacgcctaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgaccgac
aaagccattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggtgcg
tcaatcgataaacaggatcatgctgcgaatccttgtgggcaaattggcgagacggtcgat
ctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggagggtaacacgctggtc
atagtcaccgctgatcacgcccacgccagccagattgttgcgccggataccaaagctccg
ggcctcacccaggcgctaaataccaaagatggcgcagtgatggtgatgagttacgggaac
tccgaagaggattcacaagaacatacaggcagtcagttgcgtattgcggcgtatggcccg
catgccgccaatgttgttggactgaccgaccagactgatctcttctacaccatgaaagcc
gccctggggctgaaataa

DBGET integrated database retrieval system