KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0683Help
Entry
ECRM13516_0683    CDS       T03011                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00020  Citrate cycle (TCA cycle)
ecoh00190  Oxidative phosphorylation
ecoh00650  Butanoate metabolism
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01120  Microbial metabolism in diverse environments
ecoh01130  Biosynthesis of antibiotics
ecoh01200  Carbon metabolism
Module
ecoh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecoh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecoh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECRM13516_0683 (sdhA)
   00650 Butanoate metabolism
    ECRM13516_0683 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECRM13516_0683 (sdhA)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECRM13516_0683 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECRM13516_0683 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AHG13363
LinkDB All DBs
Structure
PDB: 

Position
729937..731703
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtgaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtctcgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcagcggctgaccgt
accggtcacgcactgttgcacacgctttatcagcagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
accgcactgtgcatcgaaaccggtgaagtggtttattttaaagcccgcgctaccgtgctg
gcgactggcggagcagggcgtatttatcagtctaccactaacgcccacattaacaccggc
gacggcgtcggcatggctatccgcgcaggcgtaccggtgcaggatatggaaatgtggcaa
ttccacccgaccggcattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgatcacctgggtaaa
gaagttctcgaatcccgtctgccgggtatcctggagctttcccgtaccttcgctcacgtt
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagttaccggtcaggcgctgactgtgaatgagaaaggcgaagatgtggttgtt
ccggggctgttcgcggtaggtgaaattgcctgcgtatcggtacacggtgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcagcgggtctgcatctgcaa
gagtctatcgccgagcagggcgcattgcgcgatgccagcgagtctgatgttgaagcatct
ctggatcgtctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgatccgt
aaagcactgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaaggtcttgagcagttgaaagttatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system