KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_1896Help
Entry
ECRM13516_1896    CDS       T03011                                 

Gene name
marR
Definition
(GenBank) Multiple antibiotic resistance protein MarR
  KO
K03712  MarR family transcriptional regulator, multiple antibiotic resistance protein MarR
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecoh03000]
    ECRM13516_1896 (marR)
Transcription factors [BR:ecoh03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    ECRM13516_1896 (marR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HNH_5 FeoC HTH_24 TrmB AbiEi_4
Motif
Other DBs
NCBI-ProteinID: AHG14564
LinkDB All DBs
Structure
PDB: 

Position
1902159..1902593
Genome map
AA seq 144 aa AA seqDB search
MKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVEL
KKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTSGAAICEQCHQLVGQDLH
QELTKNLTADEVATLEHLLKKVLP
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtaccagcgatctgttcaatgaaattattccattgggtcgcttaatccatatg
gttaatcagaagaaagatcgtctgcttaacgagtatctgtctccgctggatattaccgcg
gcacagtttaaggtgctctgctctatccgctgcgcggcgtgtattactccggttgaactg
aaaaaagtgttgtcggtcgacctgggagcactgacccgtatgctggatcgcctggtctgt
aaaggctgggtggaaaggttgccgaacccgaatgataagcgcggcgtactggtaaaactt
accaccagcggcgcggcaatatgtgaacaatgccatcaattagttggccaggacctgcat
caagaattaacaaaaaacctgacggcggacgaagtggcaacacttgagcatttgcttaag
aaagtcctgccgtaa

DBGET integrated database retrieval system