KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2316
Entry
ECRM13516_2316    CDS       T03011                                 

Gene name
stx2A
Definition
(GenBank) Shiga-like toxin II subunit A precursor
  KO
K11006  shiga toxin subunit A
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh02024  Quorum sensing
ecoh05130  Pathogenic Escherichia coli infection
Module
ecoh_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECRM13516_2316 (stx2A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2316 (stx2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ecoh02042]
    ECRM13516_2316 (stx2A)
Bacterial toxins [BR:ecoh02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECRM13516_2316 (stx2A)
SSDB
Motif
Pfam: RIP Plug
Other DBs
NCBI-ProteinID: AHG14984
LinkDB
Structure
PDB: 
4M1U 1R4P

Position
complement(2295053..2296012)
AA seq 319 aa
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPDVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagtgtatattatttaaatgggtactgtgcctgttactgggtttttcttcggtatcc
tattcccgggaatttacgatagacttttcgactcaacaaagttatgtctcttcgttaaat
agtatacggacagagatatcgacccctcttgaacatatatctcaggggaccacatcggtg
tctgttattaaccacaccccgccgggcagttattttgctgtggatatacgagggcttgat
gtctatcaggcgcgttttgaccatcttcgtctgattattgagcaaaataatttatatgtg
gccgggttcgttaatacggcaacaaatactttctaccgtttttcagattttacacatata
tcagtgcccgatgtgacaacggtttccatgacaacggacagcagttataccactctgcaa
cgtgtcgcagcgctggaacgttccggaatgcaaatcagtcgtcactcactggtttcatca
tatctggcgttaatggagttcagtggtaatacaatgaccagagatgcatccagagcagtt
ctgcgttttgtcactgtcacggcagaagccttacgcttcaggcagatacagagagaattt
cgtcaggcactgtctgaaactgctcctgtgtatacgatgacgccgggagacgtggacctc
actctgaactgggggcgaatcagcaatgtgcttccggagtatcggggagaggatggtgtc
agagtggggagaatatcctttaataatatatcagcgatactgggtactgtggccgttata
ctgaattgccatcatcagggggcgcgttctgttcgcgccgtgaatgaagagagtcaacca
gaatgtcagataactggcgacaggcccgttataaaaataaacaatacattatgggaaagt
aatacagctgcagcgtttctgaacagaaagtcacagtttttatatacaacgggtaaataa

DBGET integrated database retrieval system