KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2720
Entry
ECRM13516_2720    CDS       T03011                                 

Gene name
gatD
Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00052  Galactose metabolism
ecoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECRM13516_2720 (gatD)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECRM13516_2720 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N PrmA Methyltransf_25 ELFV_dehydrog MTS TrkA_N FAD_binding_2 Sacchrp_dh_NADP ThiF
Other DBs
NCBI-ProteinID: AHG15376
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2665783..2666613)
AA seq 276 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKI
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggatttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgagccgattaccgttggtctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggccattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggcgatcgacattagttcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatatag

DBGET integrated database retrieval system