KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2940Help
Entry
ECRM13516_2940    CDS       T03011                                 

Gene name
glpA
Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00564  Glycerophospholipid metabolism
ecoh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECRM13516_2940 (glpA)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECRM13516_2940 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Lycopene_cycl Pyr_redox_3 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AHG15592
LinkDB All DBs
Position
2896806..2898434
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLQEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccgggattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcagtaaccgatgcggaatcggcccgcgaatgcattagtgaaaaccagatcctgaaacgc
attgcacgtcactgcgttgaaccaactaacggcctgtttatcaccctgcaggaagatgac
ctctccttccaggccacttttattcgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaacatgctggat
gccaaagaacacggtgccgttatccttactgctcatgaagtcacgggactgattcgtgaa
ggcgcgacggtgtgcggtgttcgtgtacgtaaccatctcaccggcgaaactcaggccctt
catgcgcctgtcgtggttaatgccgccgggatctgggggcaacacattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaaggatcgctgctgatcatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgcaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctaattggcaccacctctttacgtattgattacaatgagattgacgat
aatcgagtgacggcagaagaggttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctattctggcgtgcgcccgctggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggctgaatgggctaccgacgcggtatgccgcaaactgggcaacacgcgcccctgtacg
accgccgatctggcacttcctgggtcacaggaacccgctgaagtcaccttgcgtaaagtc
atctccctgcctgccccgctgcgcggttctgcggtttatcgtcatggcgatcgcacgcct
gcctggctgagcgaaggccgtctgcaccgtagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcggtagaaaatttaaacgttaatagcctgctggatttacgc
cgtcgtacccgtgtggggatgggtacctgccagggcgaactctgcgcctgccgcgctgcc
ggactgctgcaacggtttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatcgcctggggagatgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system