KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4130Help
Entry
ECRM13516_4130    CDS       T03011                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01130  Biosynthesis of antibiotics
ecoh01230  Biosynthesis of amino acids
Module
ecoh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECRM13516_4130 (aroK)
Enzymes [BR:ecoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ECRM13516_4130 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK TsaE AAA_16 AAA AAA_22 AAA_7 ABC_tran APS_kinase RsgA_GTPase IstB_IS21 His_biosynth AAA_PrkA AAA_5 Ploopntkinase3 AAA_17 RNA_helicase AAA_25 AAA_29 G-alpha TniB PduV-EutP AAA_28 Zeta_toxin Mg_chelatase AAA_24 Rad17
Motif
Other DBs
NCBI-ProteinID: AHG16748
LinkDB All DBs
Structure
PDB: 

Position
complement(4071075..4071752)
Genome map
AA seq 225 aa AA seqDB search
MGDLFSCQTRWSIEIIFSLTLAISYEVSVHVLRRSLSEAGLSLTNSLSSTEKMAEKRNIF
LVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVIN
ELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLHVETP
PREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatttattcagttgccaaacccgctggagtattgagataattttcagtctgact
ctcgcaatatcttatgaggtttcagttcatgtcctgcggcgctctctgagcgaagcgggt
ttatcattaacgaatagtcttagtagtaccgaaaaaatggcagagaaacgcaatatcttt
ctggttgggcctatgggtgccggaaaaagcactattgggcgccagttagctcaacaactc
aatatggaattttacgattccgatcaagagattgagaaacgaaccggagctgatgtgggc
tgggttttcgatttagaaggcgaagaaggcttccgcgatcgcgaagaaaaggtcatcaat
gagttgaccgagaaacagggtattgtgctggctactggcggcggctctgtgaaatcccgt
gaaacgcgtaaccgtctttccgctcgtggcgttgtcgtttatcttgaaacgacgatcgaa
aagcaacttgcacgcacgcagcgtgataaaaaacgcccgttgctgcacgttgaaacaccg
ccacgtgaagttctggaagcgttggccaatgaacgcaatccgctgtatgaagagattgcc
gacgtgaccattcgtactgatgatcaaagcgctaaagtggtcgctaaccagattattcac
atgctggaaagcaactaa

DBGET integrated database retrieval system