KEGG   Escherichia coli PMV-1: ECOPMV1_00812Help
Entry
ECOPMV1_00812     CDS       T02847                                 

Gene name
glnQ
Definition
(GenBank) Glutamine transport ATP-binding protein GlnQ
  KO
K10038  glutamine transport system ATP-binding protein [EC:7.4.2.1]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECOPMV1_00812 (glnQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecoi02000]
    ECOPMV1_00812 (glnQ)
Enzymes [BR:ecoi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ECOPMV1_00812 (glnQ)
Transporters [BR:ecoi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    ECOPMV1_00812 (glnQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_23 AAA_29 AAA_22 ABC_ATPase AAA_15 RsgA_GTPase TniB AAA_18 AAA_30 AAA_33 RNA12 CobU AAA_25 ATPase_2 cobW IstB_IS21 Rad17 NACHT Mg_chelatase NB-ARC NTPase_1 SbcCD_C AAA_28 AAA_27 AAA_24 AAA_19 T2SSE AAA_14 MMR_HSR1 Adeno_IVa2 Sigma54_activat CPT AAA_7
Motif
Other DBs
NCBI-ProteinID: CDH64303
LinkDB All DBs
Position
complement(844703..845425)
Genome map
AA seq 240 aa AA seqDB search
MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV
DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLAREL
LAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQ
DLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGDPQVLIKNPPSQRLQEFLQHVS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttaaaaacgtctccaagcattttggtccaacccaggtgctgcacaatatc
gatttgaacattgctcagggcgaagtcgtggtgattatcgggccgtccggttccggtaaa
tcgaccctgctgcgctgcatcaacaaactggaagaaatcacctccggcgatctgattgtc
gatggcctgaaggttaacgatccgaaagttgatgagcgcctgattcgccaggaagcgggt
atggtgttccagcagttttacctcttcccgcatctgacggcgctggaaaacgtcatgttt
ggcccgctacgcgtgcgtggcgcgaataaagaagaggcggaaaaactggcgcgtgagctc
ctggcgaaagtcggtctggcagaacgtgcacatcactacccttccgaactttctggtggt
caacagcagcgtgtggcgattgcccgcgcgctggcggtgaagccgaaaatgatgctgttt
gatgaaccgacttccgctcttgacccggaactgcgccatgaagtgctgaaggttatgcag
gatctggctgaagaagggatgacgatggtgatcgtgacacacgaaatcggttttgccgag
aaagtagcttcgcgcctgatctttatcgacaaaggccggattgcggaagatggcgatccg
caggtgttgatcaagaacccaccgagccagcgcttgcaggaatttttgcagcacgtctct
taa

DBGET integrated database retrieval system