KEGG   Escherichia coli PMV-1: ECOPMV1_02449Help
Entry
ECOPMV1_02449     CDS       T02847                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00220  Arginine biosynthesis
ecoi00250  Alanine, aspartate and glutamate metabolism
ecoi00290  Valine, leucine and isoleucine biosynthesis
ecoi01100  Metabolic pathways
ecoi01110  Biosynthesis of secondary metabolites
ecoi01130  Biosynthesis of antibiotics
ecoi01210  2-Oxocarboxylic acid metabolism
ecoi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECOPMV1_02449
   00290 Valine, leucine and isoleucine biosynthesis
    ECOPMV1_02449
   00220 Arginine biosynthesis
    ECOPMV1_02449
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecoi01007]
    ECOPMV1_02449
Enzymes [BR:ecoi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ECOPMV1_02449
    2.6.1.66  valine---pyruvate transaminase
     ECOPMV1_02449
Amino acid related enzymes [BR:ecoi01007]
 Aminotransferase (transaminase)
  Class I
   ECOPMV1_02449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CDH65858
LinkDB All DBs
Structure
PDB: 

Position
2542624..2543841
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaattctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcagcggtttcgctctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccagacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactccattgcgccgctggcacctgacctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggttacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcactgggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaattgatcaacgatatt
ccgggcgtttcctgcgtgaaacctcgtggtgcgctgtatatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gtcctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system