KEGG   Escherichia coli PMV-1: ECOPMV1_02482Help
Entry
ECOPMV1_02482     CDS       T02847                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase 1
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00061  Fatty acid biosynthesis
ecoi00780  Biotin metabolism
ecoi01100  Metabolic pathways
ecoi01212  Fatty acid metabolism
Module
ecoi_M00083  Fatty acid biosynthesis, elongation
ecoi_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECOPMV1_02482 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECOPMV1_02482 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecoi01004]
    ECOPMV1_02482 (fabB)
Enzymes [BR:ecoi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     ECOPMV1_02482 (fabB)
Lipid biosynthesis proteins [BR:ecoi01004]
 Fatty acid synthase
  Component type
   ECOPMV1_02482 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: CDH65891
LinkDB All DBs
Structure
PDB: 

Position
complement(2575720..2576940)
Genome map
AA seq 406 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI
DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM
RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT
STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtgattactggcctgggcattgtttccagcatcggtaataaccagcag
gaagtcctggcatctctgcgtgaaggacgttcagggatcactttctctcaggagctgaag
gattccggcatgcgtagccacgtctggggcaacgtaaaactggataccactggcctcatt
gaccgcaaagttgtgcgctttatgagcgacgcatccatttatgcattcctttctatggag
caggcaattgcagatgctggcctctccccggaagcttaccagaataacccgcgcgttggc
ctgattgcaggttccggcggcggttccccgcgtttccaggttttcggcgctgacgcaatg
cgcggcccgcgcggcctgaaagcggttggcccgtatgtggtcaccaaagcgatggcatcc
ggcgtttctgcctgcctcgccacgccgtttaaaattcacggcgttaactactccatcagc
tccgcgtgtgcgacttccgcacactgtatcggtaacgcagtagagcagatccaactgggc
aaacaggacatcgtgtttgctggcggcggcgaagagctgtgctgggaaatggcttgcgaa
ttcgacgcgatgggtgcgctgtctactaaatacaacgacaccccggaaaaagcctcccgt
acttacgacgctcaccgtgacggtttcgttatcgctggcggtggcggtatggtagtggtt
gaagagctggaacacgcgctggcgcgtggtgctcacatctatgctgaaatcgttggctac
ggcgcaacctctgatggcgcagacatggttgctccgtctggcgaaggcgcagtgcgctgc
atgaagatggcgatgcacggtgttgataccccaatcgactacctgaactctcatggtact
tcgactccggttggcgacgtgaaagaactggcagctatccgtgaagtgttcggcgataag
agcccggcgatttctgcaaccaaagcaatgaccggtcactcactgggcgctgctggcgta
caggaagctatctactctctgctgatgctggaacacggttttatcgccccgagcatcaac
attgaagagctggacgagcaggctgcgggtctgaacatcgtgaccgaaacgaccgatcgc
gaactgaccacagttatgtctaacagcttcggcttcggcggcactaacgccacgctggta
atgcgcaagctgaaagattaa

DBGET integrated database retrieval system