KEGG   Escherichia coli PMV-1: ECOPMV1_02913Help
Entry
ECOPMV1_02913     CDS       T02847                                 

Gene name
gabD
Definition
(GenBank) Succinate-semialdehyde dehydrogenase [NADP(+)] GabD
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00250  Alanine, aspartate and glutamate metabolism
ecoi00310  Lysine degradation
ecoi00350  Tyrosine metabolism
ecoi00650  Butanoate metabolism
ecoi00760  Nicotinate and nicotinamide metabolism
ecoi01100  Metabolic pathways
ecoi01120  Microbial metabolism in diverse environments
Module
ecoi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECOPMV1_02913 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECOPMV1_02913 (gabD)
   00310 Lysine degradation
    ECOPMV1_02913 (gabD)
   00350 Tyrosine metabolism
    ECOPMV1_02913 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECOPMV1_02913 (gabD)
Enzymes [BR:ecoi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     ECOPMV1_02913 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     ECOPMV1_02913 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     ECOPMV1_02913 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CDH66291
LinkDB All DBs
Structure
PDB: 

Position
2988956..2990404
Genome map
AA seq 482 aa AA seqDB search
MKLNDSNLFRQQALINGEWLDANNGEVIDVTNPANGDKLGSVPKMGADETRAAIDAANRA
LPVWRALTAKERANILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFA
EEGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLK
PASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQ
LMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQNG
VYDRFAEKLQQAVSKLHIGNGLEKGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKA
HERGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYA
RDLSRVFRVGEALEYGIIGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCI
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaacgacagtaacttattccgccagcaggcgttgattaacggggaatggctg
gacgccaacaatggcgaggtcatcgacgtcaccaatccggcgaacggcgacaagctgggt
agcgtgccgaaaatgggcgctgatgaaacccgcgccgctatcgacgccgccaaccgcgcc
ctgcccgtctggcgtgcgctcactgccaaagaacgcgccaacattctgcgcaactggttc
aatttaatgatggagcatcaggacgatttagcgcgcctgatgaccctcgaacagggcaaa
ccactggctgaagcgaaaggcgaaatcagctacgccgcctcatttattgagtggtttgca
gaagaaggcaaacgtatttatggcgacaccattcccggtcatcaggccgataaacgcctg
attgttatcaagcagccgattggcgtcaccgcggctatcacgccgtggaacttcccggcg
gcgatgattacccgtaaagccggtccggcgctggcggcaggctgcacgatggtgctgaag
cccgccagtcagacgccgttctctgcgctggcgctggcagaactggcgattcgcgcgggc
gttccggctggcgtgtttaacgtagtcaccggttcggcgggcgcggtcggtaacgaactg
accagcaacccgctggtgcgcaagctgtcgtttaccggctcgaccgaaattggccgtcag
ttaatggaacagtgcgcgaaagacatcaaaaaagtgtcgctggagctgggcggcaacgca
ccgtttattgtctttgacgatgccgatctcgataaagccgtggaaggcgcgctggcctcg
aaattccgtaacgccgggcaaacctgcgtctgcgccaaccgcctgtatgtgcagaacggc
gtgtatgaccgctttgccgaaaaattgcagcaggcggtgagcaaactgcacatcggcaac
gggctggagaaaggcgtcaccatcgggccgctgatcgatgaaaaagcggtagcaaaagtg
gaagagcatattgccgatgcgctggagaaaggcgcgcgcgtggtttgcggcggtaaagca
catgaacgcggcggtaacttcttccagccgaccattctggtggacgttccggctaacgcc
aaagtgtcgaaagaagagacgtttggccccctcgccccgctgttccgttttaaagatgaa
gccgatgtgattgcgcaagccaatgacaccgaatttggccttgcagcctatttctacgcc
cgtgatttaagccgcgtcttccgcgtgggcgaagcactggagtacggcatcatcggcatc
aacaccggcattatttccaatgaagtggccccgtttggcggcattaaagcctcgggtctg
ggtcgtgaaggttcgaagtatggcatcgaagattacttagaaatcaaatatatgtgcatc
ggtctttaa

DBGET integrated database retrieval system