KEGG   Escherichia coli PMV-1: ECOPMV1_04315Help
Entry
ECOPMV1_04315     CDS       T02847                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00010  Glycolysis / Gluconeogenesis
ecoi00030  Pentose phosphate pathway
ecoi00051  Fructose and mannose metabolism
ecoi00052  Galactose metabolism
ecoi00680  Methane metabolism
ecoi01100  Metabolic pathways
ecoi01110  Biosynthesis of secondary metabolites
ecoi01120  Microbial metabolism in diverse environments
ecoi01130  Biosynthesis of antibiotics
ecoi01200  Carbon metabolism
ecoi01230  Biosynthesis of amino acids
ecoi03018  RNA degradation
Module
ecoi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECOPMV1_04315 (pfkA)
   00030 Pentose phosphate pathway
    ECOPMV1_04315 (pfkA)
   00051 Fructose and mannose metabolism
    ECOPMV1_04315 (pfkA)
   00052 Galactose metabolism
    ECOPMV1_04315 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECOPMV1_04315 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ECOPMV1_04315 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecoi01009]
    ECOPMV1_04315 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ecoi03019]
    ECOPMV1_04315 (pfkA)
Enzymes [BR:ecoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECOPMV1_04315 (pfkA)
Protein phosphatases and associated proteins [BR:ecoi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECOPMV1_04315 (pfkA)
Messenger RNA biogenesis [BR:ecoi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECOPMV1_04315 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CDH67619
LinkDB All DBs
Structure
PDB: 

Position
4416504..4417466
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggtggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtgggatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggcctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attactgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggtggtcgttgcgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system