KEGG   Escherichia coli JJ1886: P423_00475Help
Entry
P423_00475        CDS       T02896                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00473  D-Alanine metabolism
ecoj00550  Peptidoglycan biosynthesis
ecoj01100  Metabolic pathways
ecoj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    P423_00475 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P423_00475 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    P423_00475 (ddl)
Enzymes [BR:ecoj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     P423_00475 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ecoj01011]
 Precursor biosynthesis
  Amino acid ligase
   P423_00475 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATPgrasp_YheCD ATPgrasp_ST TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AGY83134
LinkDB All DBs
Structure
PDB: 

Position
111051..111971
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQSAGLPVAPWVALTRA
EFEKGLNDKQLAEISSLGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGPEFTVAILGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASQEANLQAL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggcgggacctccgctgagcgggaagtttctctg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgacgcgtatcctgtc
gacccgaaagaagtcgacgtgacgcaactgaagtcgatgggttttcagaaagtgtttatc
gcgctacacggtcgcggcggtgaagatggtacgctgcagggcatgctcgagctgatgggc
ttgccttataccggcagcggagtgatggcatctgcgctttcaatggataaactacgcagc
aaacttctgtggcagagtgccggtttaccggtcgcgccgtgggtagcattaacccgcgca
gagtttgaaaaaggccttaacgataagcagttagcagaaatttcttctctgggtttgccg
gtaatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggccggagttcacggttgcgatactcggtgaagaaattttaccgtca
atacgtattcaaccggccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccccgcaggtctggaagcgtcacaagaggccaatttgcaggcatta
gtgctaaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagcgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agtctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system