KEGG   Escherichia coli JJ1886: P423_01950Help
Entry
P423_01950        CDS       T02896                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00730  Thiamine metabolism
ecoj00790  Folate biosynthesis
ecoj01100  Metabolic pathways
ecoj02020  Two-component system
Module
ecoj_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    P423_01950
   00790 Folate biosynthesis
    P423_01950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P423_01950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoj04147]
    P423_01950
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecoj00537]
    P423_01950
Enzymes [BR:ecoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     P423_01950
Exosome [BR:ecoj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P423_01950
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecoj00537]
 Enzymes
  P423_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AGY83349
LinkDB All DBs
Structure
PDB: 

Position
428624..430039
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggcagctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgctgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgccgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaactggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccaagtgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgcc
cgtgccgatgttacgcttggcggcggtgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctattaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggtaat
atagataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggtaacacgttggtcatagtcaccgctgatcacgcccatgccagccagatagttgcg
ccagataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system