KEGG   Escherichia coli JJ1886: P423_02405Help
Entry
P423_02405        CDS       T02896                                 

Definition
(GenBank) heat shock protein 90
  KO
K04079  molecular chaperone HtpG
Organism
ecoj  Escherichia coli JJ1886
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecoj01009]
    P423_02405
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecoj03110]
    P423_02405
   04131 Membrane trafficking [BR:ecoj04131]
    P423_02405
   03051 Proteasome [BR:ecoj03051]
    P423_02405
   03029 Mitochondrial biogenesis [BR:ecoj03029]
    P423_02405
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoj04147]
    P423_02405
Protein phosphatases and associated proteins [BR:ecoj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     P423_02405
Chaperones and folding catalysts [BR:ecoj03110]
 Heat shock proteins
  HSP90
   P423_02405
Membrane trafficking [BR:ecoj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    P423_02405
Proteasome [BR:ecoj03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    P423_02405
Mitochondrial biogenesis [BR:ecoj03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    P423_02405
Exosome [BR:ecoj04147]
 Exosomal proteins
  Proteins found in most exosomes
   P423_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c Apolipoprotein HP0268 PE
Motif
Other DBs
NCBI-ProteinID: AGY83435
LinkDB All DBs
Structure
PDB: 

Position
521610..523484
Genome map
AA seq 624 aa AA seqDB search
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGD
GELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLI
GQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHL
REGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETIISWEKINKAQALWTRNKSE
ITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLY
VQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQML
EKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYV
SRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPF
QSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVS
TDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQA
LLAERGTLEDPNLFIRRMNQLLVS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaagaaactcgtggttttcagtcagaagtgaaacagcttctgcacctgatg
atccattctctctattccaataaagaaatcttcctgcgtgagcttatctctaacgcctcc
gatgcggcggacaagctgcgtttccgcgcgctttctaacccggacctgtacgaaggtgat
ggtgaactacgcgttcgtgtctctttcgataaagacaagcgcacgctgaccatctccgat
aacggcgtggggatgacccgcgacgaagtgattgaccatctggggactatcgctaaatcc
ggcaccaaatcattcctcgaatccctgggttctgaccaggcgaaagacagccagctgatc
ggtcagtttggtgttggtttctactctgcgtttatcgtggctgacaaagtgaccgtgcgt
actcgcgcggcaggcgaaaaaccagaaaacggcgtcttctgggaatcggctggcgaaggt
gaatacaccgttgccgacatcactaaagaagatcgtggtactgaaatcaccctgcatctg
cgtgaaggcgaagacgagttcctcgatgactggcgtgtgcgttccatcatcagcaaatat
tccgaccatatcgcgctgccggtagagatcgaaaaacgcgaagagaaagacggcgaaacc
attatctcctgggagaaaatcaacaaagcgcaggcgctgtggactcgtaacaagtcggaa
atcaccgatgaagagtacaaagagttctacaaacacatcgcccacgactttaacgatccg
ctgacctggagccacaaccgcgttgaaggtaagcaggagtacaccagcctgctgtacatt
ccgtctcaggcaccgtgggatatgtggaaccgcgatcataaacacggtctgaaactgtat
gttcagcgtgtgttcatcatggacgacgcagaacagttcatgccgaactatctgcgcttc
gtgcgtggtctgattgactccagcgatctgccgctgaacgtttcccgtgaaatcctccag
gacagcacggtaacgcgtaacctgcgcaatgcgctgaccaagcgtgtgctgcaaatgctg
gaaaaactggcgaaagacgacgcggaaaaataccagaccttctggcaacagtttggcctg
gtactgaaagaaggtccggcggaagatttcgctaaccaggaagcgatcgccaaactgctg
cgttttgcttctacccataccgattcttctgcgcagaccgtgtctctggaagactacgtt
tcccgcatgaaagaagggcaggagaaaatctactatatcaccgcagacagctacgcggca
gcgaagagcagcccgcacctggaactgctgcgtaagaaaggcatcgaagttctgctgctt
tccgaccgcatcgatgagtggatgatgaactatctgactgagttcgacggtaaaccgttc
cagtctgtgtctaaagttgacgagtcgctggaaaaactggctgacgaagttgatgagagc
gcgaaagaagcggagaaagcactgactccgttcatcgaccgtgtgaaagccctgctcggc
gagcgcgtgaaagatgtccgtctgactcaccgtctgaccgatacgccagcgatcgtttcg
accgacgcggacgaaatgagcactcagatggcgaaactgttcgctgcggcgggccagaaa
gtgccagaagtgaaatacatcttcgaactgaacccggatcacgtactggtgaaacgtgcg
gcggatactgaagatgaagcgaagttcagcgagtgggtagaactgctgctggatcaggcg
ctgctggcagaacgcggcacgctggaagatccgaacctgtttattcgtcgtatgaaccag
ctgctggtttcctga

DBGET integrated database retrieval system