KEGG   Escherichia coli JJ1886: P423_03725Help
Entry
P423_03725        CDS       T02896                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecoj01100  Metabolic pathways
ecoj01110  Biosynthesis of secondary metabolites
ecoj01130  Biosynthesis of antibiotics
ecoj01230  Biosynthesis of amino acids
ecoj02024  Quorum sensing
Module
ecoj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P423_03725
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    P423_03725
Enzymes [BR:ecoj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     P423_03725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AGY83640
LinkDB All DBs
Structure
PDB: 

Position
794664..795716
Genome map
AA seq 350 aa AA seqDB search
MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGP
CSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQIN
DGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPN
YSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVM
VESHLVEGNQSLESGEPLAYGKSITDACIGWDDTDALLRQLANAVKARRG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcagaacgacgatttacgcatcaaagaaatcaaagagttacttcctcctgtc
gcattgctggaaaaattccccgctactgaaaatgccgcgaatacggtcgcccatgcccga
aaagcgatccataagatcctgaaaggtaatgatgatcgcctgttggtggtgattggccca
tgctcaattcatgatcctgtcgcggctaaagagtatgccactcgcttgctggcgctgcgt
gaagagctgaaagatgagctggaaatcgtaatgcgcgtctattttgaaaagccgcgtacc
acggtgggctggaaagggctgattaacgatccgcatatggataacagcttccagatcaac
gacggtctgcgtattgcccgtaaattgttgcttgatattaacgacagcggtctgccagcg
gcgggtgagtttctcgatatgatcaccccacaatatctcgctgacctgatgagctggggc
gcaattggcgcacgtactacggaatcgcaggtgcaccgcgaactggcttcagggctttct
tgcccggtaggcttcaaaaatggcactgatggtacgattaaagtggctatcgatgccatt
aatgccgccggtgcgccgcactgcttcctttcagtgaccaaatggggtcattcggcgatt
gtgaataccagcggtaacggcgattgccatatcattctgcgcggcggtaaagagcctaac
tacagcgcgaagcacgttgctgaagtgaaagaagggctgaacaaagcaggcctgccagca
caggtgatgatcgatttcagccatgctaactcgtctaaacaattcaaaaagcagatggat
gtttgtgctgacgtttgccagcagattgccggtggcgaaaaggccattattggcgtgatg
gtggaaagccatctggtggaaggcaatcagagcctcgagagcggggaaccgctggcctac
ggtaagagcatcaccgatgcctgcattggctgggatgataccgatgctctgttacgtcaa
ctggcgaatgcagtaaaagcgcgtcgcgggtaa

DBGET integrated database retrieval system