KEGG   Escherichia coli JJ1886: P423_12155Help
Entry
P423_12155        CDS       T02896                                 

Gene name
rihB
Definition
(GenBank) ribonucleoside hydrolase
  KO
K10213  ribosylpyrimidine nucleosidase [EC:3.2.2.8]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00230  Purine metabolism
ecoj00240  Pyrimidine metabolism
ecoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P423_12155 (rihB)
   00240 Pyrimidine metabolism
    P423_12155 (rihB)
Enzymes [BR:ecoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.8  ribosylpyrimidine nucleosidase
     P423_12155 (rihB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: AGY84964
LinkDB All DBs
Structure
PDB: 

Position
complement(2455004..2455945)
Genome map
AA seq 313 aa AA seqDB search
MEKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAENTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagaaaaattattctggattgtgatccgggtcatgatgatgctattgctata
atgatggcggcgaaacatcctgcgattgatttattaggtatcaccattgtagcgggtaat
caaaccctcgataaaacattaattaatggcctgaatgtttgccagaaactggagattaat
gttccggtttatgcggggatgccgcagcccattatgcgtcaacaaattgttgccgataat
attcacggtgaaaccggactggatggcccggtattcgagccgctgacccgccaggcagaa
aacactcatgcggtgaaatatatcatcgatacccttatggcaagcgatggcgatatcact
ctggtgccggttggtccgttgtcaaacatcgcggtggcaatgcgtatgcaacccgcgatc
ctgccgaaaatccgtgaaattgttctgatgggcggcgcttatggtactggcaacttcacc
ccatctgctgagttcaatatctttgctgacccggaagccgcacgcgtggtgttcacctcc
ggcgttccattagtgatgatgggcctcgatcttaccaaccagaccgtttgcaccccggac
gtgattgctcggatggaaagggctggcggccctgcgggagagctgttcagcgacatcatg
aacttcactctcaaaacgcagttcgaaaactacggcctggctggcggcccggtgcacgac
gccacctgcatcggttatttgattaaccctgatggcattaaaacccaggagatgtacgtc
gaagtggacgttaacagtggcccttgctatgggcgtaccgtctgcgacgagttgggcgtt
cttggcaagcccgccaataccaaagtcggcatcactattgatacagactggttctgggga
ttagtcgaagagtgcgtacgcggctacatcaaaacccattaa

DBGET integrated database retrieval system