KEGG   Escherichia coli JJ1886: P423_13035Help
Entry
P423_13035        CDS       T02896                                 

Gene name
fadJ
Definition
(GenBank) fatty-acid oxidation protein subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00071  Fatty acid degradation
ecoj00280  Valine, leucine and isoleucine degradation
ecoj00281  Geraniol degradation
ecoj00310  Lysine degradation
ecoj00362  Benzoate degradation
ecoj00380  Tryptophan metabolism
ecoj00410  beta-Alanine metabolism
ecoj00640  Propanoate metabolism
ecoj00650  Butanoate metabolism
ecoj00903  Limonene and pinene degradation
ecoj00930  Caprolactam degradation
ecoj01100  Metabolic pathways
ecoj01110  Biosynthesis of secondary metabolites
ecoj01120  Microbial metabolism in diverse environments
ecoj01130  Biosynthesis of antibiotics
ecoj01200  Carbon metabolism
ecoj01212  Fatty acid metabolism
Module
ecoj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    P423_13035 (fadJ)
   00650 Butanoate metabolism
    P423_13035 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P423_13035 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P423_13035 (fadJ)
   00310 Lysine degradation
    P423_13035 (fadJ)
   00380 Tryptophan metabolism
    P423_13035 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P423_13035 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    P423_13035 (fadJ)
   00281 Geraniol degradation
    P423_13035 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P423_13035 (fadJ)
   00930 Caprolactam degradation
    P423_13035 (fadJ)
Enzymes [BR:ecoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     P423_13035 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     P423_13035 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     P423_13035 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGY85130
LinkDB All DBs
Position
complement(2649151..2651295)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKFSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKMPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGERFSASANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGVQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCDRLVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggaatttgcctcgcaggtacgc
gccattattaagcaactccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggaggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcggta
aagctggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgttcgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
gggaccagcagtggctatgacgccgaagctcgggcgtttggtgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagtacggacgtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattctaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagttcagttgggatcagcttgagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatatcgccgctcacgccacgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaatgccaattgtcgtgcgtgacaaagctgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
gccgcgctagtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacacagggactaaaattatgcctgtactggaagccgcttatggagaacgttttagc
gcgtctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgtacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgatcgtttagttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system