KEGG   Escherichia coli K-12 MDS42: ECMDS42_1100Help
Entry
ECMDS42_1100      CDS       T02541                                 

Gene name
puuE
Definition
(GenBank) GABA aminotransferase, PLP-dependent
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00250  Alanine, aspartate and glutamate metabolism
ecok00410  beta-Alanine metabolism
ecok00640  Propanoate metabolism
ecok00650  Butanoate metabolism
ecok01100  Metabolic pathways
ecok01120  Microbial metabolism in diverse environments
Module
ecok_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecok00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECMDS42_1100 (puuE)
   00650 Butanoate metabolism
    ECMDS42_1100 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECMDS42_1100 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECMDS42_1100 (puuE)
Enzymes [BR:ecok01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECMDS42_1100 (puuE)
Amino acid related enzymes [BR:ecok01007]
 Aminotransferase (transaminase)
  Class III
   ECMDS42_1100 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAL38366
LinkDB All DBs
Position
1169779..1171044
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccactccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgccacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccggacatcgccaccctgat
ctggtcgcggcggtggagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcaccaccggtgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgccctggcgtgattgcgtttagcggcggctttcacggtcgt
acgtatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgctattcgccgcctgtgcgacgagcacggtattgtgatgattgctgatgaagtg
caaagcggctttgcgcgtaccggtaagctgtttgccatggatcattacgccgataagccg
gatttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcacccgcgccgggcgggcttggcggcacctacgccggtaac
ccgctggcggtggctgccgcgcacgcggtgctcaacattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggtagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system