KEGG   Escherichia coli K-12 MDS42: ECMDS42_1887Help
Entry
ECMDS42_1887      CDS       T02541                                 

Gene name
accD
Definition
(GenBank) acetylCoA carboxylase, beta (carboxyltranferase) subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00061  Fatty acid biosynthesis
ecok00620  Pyruvate metabolism
ecok00640  Propanoate metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01120  Microbial metabolism in diverse environments
ecok01130  Biosynthesis of antibiotics
ecok01200  Carbon metabolism
ecok01212  Fatty acid metabolism
Module
ecok_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECMDS42_1887 (accD)
   00640 Propanoate metabolism
    ECMDS42_1887 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECMDS42_1887 (accD)
Enzymes [BR:ecok01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     ECMDS42_1887 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ECMDS42_1887 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DZR OrfB_Zn_ribbon Zn-ribbon_8 CpXC zf-FPG_IleRS Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: BAL39107
LinkDB All DBs
Structure
PDB: 

Position
complement(2003379..2004293)
Genome map
AA seq 304 aa AA seqDB search
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGVVVPPVPDQ
EPEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgaattaaaagcaacattactcccacccgcaaggcgagcattcct
gaaggggtgtggactaagtgtgatagctgcggtcaggttttataccgcgctgagctggaa
cgtaatcttgaggtctgtccgaagtgtgaccatcacatgcgtatgacagcgcgtaatcgc
ctgcatagcctgttagatgaaggaagccttgtggagctgggtagcgagcttgagccgaaa
gatgtgctgaagtttcgtgactccaagaagtataaagaccgtctggcatctgcgcagaaa
gaaaccggcgaaaaagatgcgctggtggtgatgaaaggcactctgtatggaatgccggtt
gtcgctgcggcattcgagttcgcctttatgggcggttcaatggggtctgttgtgggtgca
cgtttcgtgcgtgccgttgagcaggcgctggaagataactgcccgctgatctgcttctcc
gcctctggtggcgcacgtatgcaggaagcactgatgtcgctgatgcagatggcgaaaacc
tctgcggcactggcaaaaatgcaggagcgcggcttgccgtacatctccgtgctgaccgac
ccgacgatgggcggtgtttctgcaagtttcgccatgctgggcgatctcaacatcgctgaa
ccgaaagcgttaatcggctttgccggtccgcgtgttatcgaacagaccgttcgcgaaaaa
ctgccgcctggattccagcgcagtgaattcctgatcgagaaaggcgcgatcgacatgatc
gtccgtcgtccggaaatgcgcctgaaactggcgagcattctggcgaagttgatgaatctg
ccagcgccgaatcctgaagcgccgcgtgaaggcgtagtggtacccccggtaccggatcag
gaacctgaggcctga

DBGET integrated database retrieval system