KEGG   Escherichia coli K-12 MDS42: ECMDS42_2442Help
Entry
ECMDS42_2442      CDS       T02541                                 

Gene name
galP
Definition
(GenBank) D-galactose transporter
  KO
K08137  MFS transporter, SP family, galactose:H+ symporter
Organism
ecok  Escherichia coli K-12 MDS42
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecok02000]
    ECMDS42_2442 (galP)
Transporters [BR:ecok02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    ECMDS42_2442 (galP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2 SHR3_chaperone MFS_1_like MFS_4
Motif
Other DBs
NCBI-ProteinID: BAL39629
LinkDB All DBs
Position
2594942..2596336
Genome map
AA seq 464 aa AA seqDB search
MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSS
MMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVG
VASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIP
AILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWA
LFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTN
VLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIV
GFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWV
YAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgctaaaaaacaggggcggtcaaacaaggcaatgacgtttttcgtctgcttc
cttgccgctctggcgggattactctttggcctggatatcggtgtaattgctggcgcactg
ccgtttattgcagatgaattccagattacttcgcacacgcaagaatgggtcgtaagctcc
atgatgttcggtgcggcagtcggtgcggtgggcagcggctggctctcctttaaactcggg
cgcaaaaagagcctgatgatcggcgcaattttgtttgttgccggttcgctgttctctgcg
gctgcgccaaacgttgaagtactgattctttcccgcgttctactggggctggcggtgggt
gtggcctcttataccgcaccgctgtacctctctgaaattgcgccggaaaaaattcgtggc
agtatgatctcgatgtatcagttgatgatcactatcgggatcctcggtgcttatctttct
gataccgccttcagctacaccggtgcatggcgctggatgctgggtgtgattatcatcccg
gcaattttgctgctgattggtgtcttcttcctgccagacagcccacgttggtttgccgcc
aaacgccgttttgttgatgccgaacgcgtgctgctacgcctgcgtgacaccagcgcggaa
gcgaaacgcgaactggatgaaatccgtgaaagtttgcaggttaaacagagtggctgggcg
ctgtttaaagagaacagcaacttccgccgcgcggtgttccttggcgtactgttgcaggta
atgcagcaattcaccgggatgaacgtcatcatgtattacgcgccgaaaatcttcgaactg
gcgggttataccaacactaccgagcaaatgtgggggaccgtgattgtcggcctgaccaac
gtacttgccacctttatcgcaatcggccttgttgaccgctggggacgtaaaccaacgcta
acgctgggcttcctggtgatggctgctggcatgggcgtactcggtacaatgatgcatatc
ggtattcactctccgtcggcgcagtatttcgccatcgccatgctgctgatgtttattgtc
ggttttgccatgagtgccggtccgctgatttgggtactgtgctccgaaattcagccgctg
aaaggccgcgattttggcatcacctgctccactgccaccaactggattgccaacatgatc
gttggcgcaacgttcctgaccatgctcaacacgctgggtaacgccaacaccttctgggtg
tatgcggctctgaacgtactgtttatcctgctgacattgtggctggtaccggaaaccaaa
cacgtttcgctggaacatattgaacgtaatctgatgaaaggtcgtaaactgcgcgaaata
ggcgctcacgattaa

DBGET integrated database retrieval system