KEGG   Escherichia coli K-12 MDS42: ECMDS42_2871Help
Entry
ECMDS42_2871      CDS       T02541                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase, aerobic, FAD/NAD(P)-binding
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00564  Glycerophospholipid metabolism
ecok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECMDS42_2871 (glpD)
Enzymes [BR:ecok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECMDS42_2871 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: BAL40038
LinkDB All DBs
Structure
PDB: 

Position
3013939..3015444
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcttgccgggatca
actggtttgcgttttggcgcaaattcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcttggttaacgccaccggcccgtgggtgaaacagttcttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgcgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcactaccgatgtcgagtacaaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaattacctgctgaatgtgtataacacgcacttt
aaaaagcagttaagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatattcatgat
gaaaatggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcggaacatgcgctggaaaaactaacgccgtattatcagggtattggcccggcatgg
acgaaagagagtgtgctaccgggtggcgccattgaaggcgaccgcgacgattatgccgct
cgcctgcgccgccgctatccgttcctgactgaatcgctggcgcgtcattacgctcgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggaacggtaagcgatctcggggaa
gatttcggtcatgagttctacgaagcggagctgaaatacctggtggatcacgaatgggtc
cgccgcgccgacgacgccctgtggcgtcgcacaaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctggtggagtatacgcagcagaggttatcgctggcg
tcgtaa

DBGET integrated database retrieval system