KEGG   Escherichia coli K-12 MDS42: ECMDS42_3463Help
Entry
ECMDS42_3463      CDS       T02541                                 

Gene name
pgi
Definition
(GenBank) glucosephosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00010  Glycolysis / Gluconeogenesis
ecok00030  Pentose phosphate pathway
ecok00500  Starch and sucrose metabolism
ecok00520  Amino sugar and nucleotide sugar metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01120  Microbial metabolism in diverse environments
ecok01200  Carbon metabolism
Module
ecok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecok_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECMDS42_3463 (pgi)
   00030 Pentose phosphate pathway
    ECMDS42_3463 (pgi)
   00500 Starch and sucrose metabolism
    ECMDS42_3463 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    ECMDS42_3463 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecok04147]
    ECMDS42_3463 (pgi)
Enzymes [BR:ecok01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     ECMDS42_3463 (pgi)
Exosome [BR:ecok04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECMDS42_3463 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   ECMDS42_3463 (pgi)
  Exosomal proteins of colorectal cancer cells
   ECMDS42_3463 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: BAL40582
LinkDB All DBs
Structure
PDB: 

Position
3662971..3664620
Genome map
AA seq 549 aa AA seqDB search
MKNINPTQTAAWQALQKHFDEMKDVTIADLFAKDGDRFSKFSATFDDQMLVDYSKNRITE
ETLAKLQDLAKECDLAGAIKSMFSGEKINRTENRAVLHVALRNRSNTPILVDGKDVMPEV
NAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKNHLNMHF
VSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSARDWFLKAAGDEKHVAKHF
AALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIVLSIGFDNFVELLSGAHAM
DKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKY
VDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLSDHHQKL
LSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLDYVVPFKVFEGNRPTNSILLREITPF
SLGALIALYEHKIFTQGVILNIFTFDQWGVELGKQLANRILPELKDDKEISSHDSSTNGL
INRYKAWRG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcaatccaacgcagaccgctgcctggcaggcactacagaaacacttcgat
gaaatgaaagacgttacgatcgccgatctttttgctaaagacggcgatcgtttttctaag
ttctccgcaaccttcgacgatcagatgctggtggattactccaaaaaccgcatcactgaa
gagacgctggcgaaattacaggatctggcgaaagagtgcgatctggcgggcgcgattaag
tcgatgttctctggcgagaagatcaaccgcactgaaaaccgcgccgtgctgcacgtagcg
ctgcgtaaccgtagcaataccccgattttggttgatggcaaagacgtaatgccggaagtc
aacgcggtgctggagaagatgaaaaccttctcagaagcgattatttccggtgagtggaaa
ggttataccggcaaagcaatcactgacgtagtgaacatcgggatcggcggttctgacctc
ggcccatacatggtgaccgaagctctgcgtccgtacaaaaaccacctgaacatgcacttt
gtttctaacgtcgatgggactcacatcgcggaagtgctgaaaaaagtaaacccggaaacc
acgctgttcttggtagcatctaaaaccttcaccactcaggaaactatgaccaacgcccat
agcgcgcgtgactggttcctgaaagcggcaggtgatgaaaaacacgttgcaaaacacttt
gcggcgctttccaccaatgccaaagccgttggcgagtttggtattgatactgccaacatg
ttcgagttctgggactgggttggcggccgttactctttgtggtcagcgattggcctgtcg
attgttctctccatcggctttgataacttcgttgaactgctttccggcgcacacgcgatg
gacaagcatttctccaccacgcctgccgagaaaaacctgcctgtactgctggcgctgatt
ggcatctggtacaacaatttctttggtgcggaaactgaagcgattctgccgtatgaccag
tatatgcaccgtttcgcggcgtacttccagcagggcaatatggagtccaacggtaagtat
gttgaccgtaacggtaacgttgtggattaccagactggcccgattatctggggtgaacca
ggcactaacggtcagcacgcgttctaccagctgatccaccagggaaccaaaatggtaccg
tgcgatttcatcgctccggctatcacccataacccgctctctgatcatcaccagaaactg
ctgtctaacttcttcgcccagaccgaagcgctggcgtttggtaaatcccgcgaagtggtt
gagcaggaatatcgtgatcagggtaaagatccggcaacgcttgactacgtggtgccgttc
aaagtattcgaaggtaaccgcccgaccaactccatcctgctgcgtgaaatcactccgttc
agcctgggtgcgttgattgcgctgtatgagcacaaaatctttactcagggcgtgatcctg
aacatcttcaccttcgaccagtggggcgtggaactgggtaaacagctggcgaaccgtatt
ctgccagagctgaaagatgataaagaaatcagcagccacgatagctcgaccaatggtctg
attaaccgctataaagcgtggcgcggttaa

DBGET integrated database retrieval system