KEGG   Escherichia coli LY180: LY180_03825Help
Entry
LY180_03825       CDS       T02846                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00020  Citrate cycle (TCA cycle)
ecol00190  Oxidative phosphorylation
ecol00650  Butanoate metabolism
ecol01100  Metabolic pathways
ecol01110  Biosynthesis of secondary metabolites
ecol01120  Microbial metabolism in diverse environments
ecol01130  Biosynthesis of antibiotics
ecol01200  Carbon metabolism
Module
ecol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecol_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY180_03825 (sdhB)
   00650 Butanoate metabolism
    LY180_03825 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LY180_03825 (sdhB)
Enzymes [BR:ecol01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LY180_03825 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     LY180_03825 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-GeneID: 16978438
NCBI-ProteinID: AGW08112
LinkDB All DBs
Structure
PDB: 

Position
817673..818389
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system