KEGG   Escherichia coli LY180: LY180_10935
Entry
LY180_10935       CDS       T02846                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00052  Galactose metabolism
ecol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LY180_10935
Enzymes [BR:ecol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     LY180_10935
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N PrmA Methyltransf_25 ELFV_dehydrog FAD_binding_2 MTS TrkA_N
Other DBs
NCBI-GeneID: 16979858
NCBI-ProteinID: AGW09333
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2280089..2281129)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacatcctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcggaaaaatgtctttgctctacctactgatatgcctattgaggatggg
gcttttattgaaccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggccattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system