KEGG   Escherichia coli LY180: LY180_11655Help
Entry
LY180_11655       CDS       T02846                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00564  Glycerophospholipid metabolism
ecol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LY180_11655 (glpA)
Enzymes [BR:ecol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LY180_11655 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Thi4 Pyr_redox_2 3HCDH_N HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-GeneID: 16980001
NCBI-ProteinID: AGW09464
LinkDB All DBs
Position
2452439..2454067
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccgggattgcccgcgactgtgccctacgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccatggcctgctgcacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgcattagtgaaaaccagatcctgaaacgc
attgcgcgtcactgtgttgaaccgactaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttattcgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggtgcg
gtgaaagttccggatggcactgttgatccatttcgtctgaccgcagcaaatatgctggat
gccaaagaacacggtgccgttattcttaccgctcatgaagtcacggggctgattcgtgaa
ggtgcgacggtgtgcggcgttcgtgtacgtaaccatctcaccggcgaaactcaggcactt
catgcgcctgtcgtggttaatgccgctgggatctgggggcaacatattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaagggtcgcttctgattatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgtaaaccttctgacgccgatattctggtgcctggc
gataccatttcgctgattggcaccacctctttacgtattgattacaacgagattgacgat
aatcgagtgacggcagaagaggttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctattctggcgtgcgcccgctggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggctgaatgggctaccgacgcggtatgccgcaaactgggcaacacgcgcccctgtacg
actgccgatctggcactgcctggttcacaagaacccgctgaagttaccttgcgtaaagtc
atctccctgcctgccccgctgcgcggttctgcggtttatcgtcatggcgatcgcacgcct
gcctggctgagcgaaggccgtctgcaccgtagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcggtagaaaatttaaacgttaatagcctgctggatttacgc
cgtcgtacccgtgtggggatgggcacctgccagggcgaactctgcgcctgccgcgctgcc
ggactgctgcaacggtttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggtgtgcaacccatcgcctggggagacgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system