KEGG   Escherichia coli LY180: LY180_13485Help
Entry
LY180_13485       CDS       T02846                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00250  Alanine, aspartate and glutamate metabolism
ecol00280  Valine, leucine and isoleucine degradation
ecol00310  Lysine degradation
ecol00410  beta-Alanine metabolism
ecol00640  Propanoate metabolism
ecol00650  Butanoate metabolism
ecol01100  Metabolic pathways
ecol01120  Microbial metabolism in diverse environments
Module
ecol_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LY180_13485
   00650 Butanoate metabolism
    LY180_13485
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LY180_13485
   00280 Valine, leucine and isoleucine degradation
    LY180_13485
   00310 Lysine degradation
    LY180_13485
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LY180_13485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecol01007]
    LY180_13485
Enzymes [BR:ecol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LY180_13485
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LY180_13485
    2.6.1.48  5-aminovalerate transaminase
     LY180_13485
Amino acid related enzymes [BR:ecol01007]
 Aminotransferase (transaminase)
  Class III
   LY180_13485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 16980367
NCBI-ProteinID: AGW09799
LinkDB All DBs
Structure
PDB: 

Position
2842890..2844170
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAGIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIINQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccacaaaacgtagcggcaccatcgcttttagcggcgcgtaccacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgcctgggcacgtttatcgcgcgctttatccttgcccgctgcacggcatcagtgaa
gatgacgctatcgccagcattcaccgaatttttaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgaaccggttcagggcgaaggcggtttctacgccgctacgcctgct
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatccatcgcgggcggcttcccgctggcgggtgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcgggctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctgaaagatggactgctggcgattgccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgggatcgtggcgcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcaaccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system