KEGG   Escherichia coli LY180: LY180_22865Help
Entry
LY180_22865       CDS       T02846                                 

Definition
(GenBank) galactonate oxidoreductase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00053  Ascorbate and aldarate metabolism
ecol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    LY180_22865
Enzymes [BR:ecol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     LY180_22865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C Pyr_redox_2 Sacchrp_dh_NADP AdoHcyase_NAD HI0933_like TrkA_N FAD_binding_3 Pyr_redox_3 Pyr_redox NAD_binding_7 NAD_binding_8 FAD_binding_2 GIDA Shikimate_DH UDPG_MGDP_dh_N Thi4 FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 16982237
NCBI-ProteinID: AGW11350
LinkDB All DBs
Position
4791418..4792440
Genome map
AA seq 340 aa AA seqDB search
MSTMNVLICQQPKELVWKQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIVGLGKNIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLSVPVANILPADGIDPQAAALIEPFAISAHAVRRAAIAPGEQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARREHVATRLELPVLDPSAEDFDAQLRAQFGGSLAQKVIDATGN
QHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA
EGKITADMMLTHRYPFATLAETYERDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgatgaatgttttaatttgccagcagccgaaagaattagtctggaaacaacgc
gagatacctattccgggtgacaatgaagcattaataaaaattaagtctgtcgggatttgc
ggtaccgatattcatgcctggggtggaaatcaaccattttttagttatccacgtgtttta
ggccatgaaatatgtggggagattgttgggctgggtaaaaatattgctgatcttaaaaat
ggtcagcaagttgctgtgatcccttatgttgcctgtcagcaatgcccggcgtgtaaaagc
gggcgtaccaattgctgtgaaaaaatttcagtcattggcgtgcatcaggatggcggtttt
agtgagtatttgagcgtgccggtggcgaacattttgcccgcagacggtattgacccgcag
gcggcagcattgattgaacctttcgctattagcgctcatgcggtgcgtcgcgcagccatt
gctcccggcgagcaggtgctggtggtcggggcggggccaatcggtctgggcgcggcggca
atcgctaaagccgatggcgcacaggtggtggtggcggataccagtccagcgcgccgtgaa
catgtggcaacgcgtctggaattacctgtactggacccgtcagccgaagattttgacgcg
cagctacgggcgcagtttggtggttcgctggcgcagaaagtgatcgacgcgacaggtaat
caacatgcgatgaataacaccgtgaatttgattcgtcacggcggcacggtggtatttgtc
ggcctgtttaaaggtgagttgcagttctccgatccggaattccataaaaaagaaacgacg
atgatgggcagccgcaacgccacgccggaagattttgctaaagtcggtcgactgatggcg
gaaggaaaaatcactgccgacatgatgttaacccatcgctatccgttcgccacgctggca
gaaacctacgagcgcgatgtgattaacaatcgtgagttgattaagggtgtaattactttc
tga

DBGET integrated database retrieval system