KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_0358Help
Entry
ECRM13514_0358    CDS       T03010                                 

Gene name
ybaS
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00220  Arginine biosynthesis
ecoo00250  Alanine, aspartate and glutamate metabolism
ecoo00471  D-Glutamine and D-glutamate metabolism
ecoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECRM13514_0358 (ybaS)
   00220 Arginine biosynthesis
    ECRM13514_0358 (ybaS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECRM13514_0358 (ybaS)
Enzymes [BR:ecoo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECRM13514_0358 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AHG07053
LinkDB All DBs
Structure
PDB: 

Position
complement(391226..392158)
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLVAVAIVTSDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNESEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtgcctggtcaactg
gtagcagtggctatcgtgaccagcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacattagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgccgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagctggtagcgctctctgacgaagtcaacgagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactgttgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggcgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system