KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_0655Help
Entry
ECRM13514_0655    CDS       T03010                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00550  Peptidoglycan biosynthesis
ecoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECRM13514_0655 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecoo01002]
    ECRM13514_0655 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecoo01011]
    ECRM13514_0655 (dacA)
Enzymes [BR:ecoo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECRM13514_0655 (dacA)
Peptidases [BR:ecoo01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ECRM13514_0655 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:ecoo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECRM13514_0655 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHG07354
LinkDB All DBs
Structure
PDB: 

Position
complement(702319..703530)
Genome map
AA seq 403 aa AA seqDB search
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV
GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaataccattttttccgctcgtatcatgaagcgcctggcgctcaccacggctctttgc
acagcctttatctctgctgcacatgccgatgacctgaatatcaaaactatgatcccgggt
gtaccgcagatcgatgcggagtcctacatcctgattgactataactccggcaaagtgctc
gccgaacagaacgcagatgtccgccgcgatcctgccagcctgaccaaaatgatgaccagt
tacgttatcggccaggcaatgaaagccggtaaatttaaagaaactgatttagtcactatc
ggcaacgacgcatgggccaccggtaacccggtgtttaaaggttcttcgctgatgttcctc
aaaccgggcatgcaggttccggtttctcagctgatccgcggtattaacctgcaatcgggt
aacgatgcttgtgtcgccatggccgattttgccgctggtagccaggacgcttttgttggc
ttgatgaacagctacgttaacgccctgggcctgaaaaatacccacttccagacggtacat
ggtctggatgctgatggtcagtacagctccgcgcgcgatatggcgctgatcggccaggca
ttgatccgtgacgtaccgaatgaatactcgatctataaagaaaaagaatttacgtttaac
ggtattcgccagctgaaccgtaacggcctgttatgggataacagcctgaatgtcgacggc
atcaaaaccggacacactgacaaagcaggttacaaccttgttgcttctgcgactgaaggc
cagatgcgcttgatttctgcggtgatgggcggacgtacttttaaaggccgtgaagccgaa
agtaaaaaactgttaacctggggcttccgtttcttcgaaaccgttaacccactgaaagta
ggtaaagagttcgcctctgaaccggtttggtttggtgattctgatcgcgcttcgttaggg
gttgataaagacgtgtacctgaccattccgcgtggccgcatgaaagatctgaaagccagc
tatgtgctgaacagcagtgaattgcatgcgccgctgcaaaagaatcaggtcgtcggaact
atcaacttccagcttgatggcaaaacgatcgaacaacgcccgctggttgtgttgcaagaa
atcccggaaggtaacttcttcggcaaaatcattgattacattaaattaatgttccatcac
tggtttggttaa

DBGET integrated database retrieval system