KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_0737Help
Entry
ECRM13514_0737    CDS       T03010                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00020  Citrate cycle (TCA cycle)
ecoo00190  Oxidative phosphorylation
ecoo00650  Butanoate metabolism
ecoo01100  Metabolic pathways
ecoo01110  Biosynthesis of secondary metabolites
ecoo01120  Microbial metabolism in diverse environments
ecoo01130  Biosynthesis of antibiotics
ecoo01200  Carbon metabolism
Module
ecoo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecoo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecoo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECRM13514_0737 (sdhB)
   00650 Butanoate metabolism
    ECRM13514_0737 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECRM13514_0737 (sdhB)
Enzymes [BR:ecoo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECRM13514_0737 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ECRM13514_0737 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AHG07430
LinkDB All DBs
Structure
PDB: 

Position
780664..781380
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNEQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggatgaaggtcgcgacatgatgctgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgtcgctcctgtcgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgccctctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatgaacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system