KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_0779Help
Entry
ECRM13514_0779    CDS       T03010                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo00010  Glycolysis / Gluconeogenesis
ecoo00260  Glycine, serine and threonine metabolism
ecoo00680  Methane metabolism
ecoo01100  Metabolic pathways
ecoo01110  Biosynthesis of secondary metabolites
ecoo01120  Microbial metabolism in diverse environments
ecoo01130  Biosynthesis of antibiotics
ecoo01200  Carbon metabolism
ecoo01230  Biosynthesis of amino acids
Module
ecoo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecoo_M00002  Glycolysis, core module involving three-carbon compounds
ecoo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECRM13514_0779 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECRM13514_0779 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECRM13514_0779 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecoo04131]
    ECRM13514_0779 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoo04147]
    ECRM13514_0779 (gpmA)
Enzymes [BR:ecoo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECRM13514_0779 (gpmA)
Membrane trafficking [BR:ecoo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECRM13514_0779 (gpmA)
Exosome [BR:ecoo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECRM13514_0779 (gpmA)
  Exosomal proteins of melanoma cells
   ECRM13514_0779 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AHG07465
LinkDB All DBs
Structure
PDB: 

Position
complement(817380..818132)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgctgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcc
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagagctgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacatggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatattccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcagccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system