KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_3144
Entry
ECRM13514_3144    CDS       T03010                                 

Gene name
stx2B
Definition
(GenBank) Shiga-like toxin II subunit B precursor
  KO
K11007  shiga toxin subunit B
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo02024  Quorum sensing
ecoo05130  Pathogenic Escherichia coli infection
Module
ecoo_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECRM13514_3144 (stx2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13514_3144 (stx2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ecoo02042]
    ECRM13514_3144 (stx2B)
Bacterial toxins [BR:ecoo02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECRM13514_3144 (stx2B)
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-ProteinID: AHG09823
LinkDB
Structure
PDB: 
4M1U 1R4P 3MXG

Position
complement(3056418..3056687)
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system