KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_4684Help
Entry
ECRM13514_4684    CDS       T03010                                 

Gene name
espF
Definition
(GenBank) T3SS secreted effector protein EspF
  KO
K12786  LEE-encoded effector EspF
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
ecoo05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13514_4684 (espF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: AHG11334
LinkDB All DBs
Position
complement(4570773..4571237)
Genome map
AA seq 154 aa AA seqDB search
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTGPSGLPPLAQALKDHLAAYEQSKKG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccaccgccaccgacagggcctagtggactaccgccccttgcacaggca
ttaaaagatcatttagctgcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system