KEGG   Eikenella corrodens: SAMEA4412678_0471Help
Entry
SAMEA4412678_0471 CDS       T05039                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecor  Eikenella corrodens
Pathway
ecor00473  D-Alanine metabolism
ecor00550  Peptidoglycan biosynthesis
ecor01100  Metabolic pathways
ecor01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAMEA4412678_0471 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAMEA4412678_0471 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SAMEA4412678_0471 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecor01011]
    SAMEA4412678_0471 (ddlB)
Enzymes [BR:ecor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAMEA4412678_0471 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ecor01011]
 Precursor biosynthesis
  Amino acid ligase
   SAMEA4412678_0471 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: SNW07232
LinkDB All DBs
Position
1:complement(465468..466430)
Genome map
AA seq 320 aa AA seqDB search
MGLPESRSKKEAKQMNKQFGKVAVLNGGFSSEREVSLDSGAAVLAALQSRGIDAHRFDPK
EQDILQLKAQGFQVAFNVLHGTYGEDGTVQALLDSIGIPYTGCGMAASALGMDKYRCKLI
WQALGLPVPDFAVLHDDTDFAAVEAELGLPMFVKPAAEGSSVGVVKVKQPGELPKVYREL
RERHLHGEIIAERFVDGGEYTCAVLGQQALPSIRIIPATEFYDYDAKYFRDDTVYQCPSD
LDAAGEAEIRRLAKAGFEAIGGRGWGRVDFLRSQSGKLYLLEINTVPGMTSHSLVPKAAA
QTGLDFADLCVEVLSHATLG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggggctacctgaaagtagaagtaagaaagaagcaaagcaaatgaacaagcagtttggc
aaagtggccgtattgaacggcggattttccagcgagcgtgaagtgtcgctcgacagcggc
gcggccgtattggccgccttgcagagccggggcatcgatgcccaccggttcgacccgaaa
gaacaagacatcctgcaactgaaagcgcagggttttcaggtagccttcaatgtgctgcac
ggcacctatggcgaagacggcaccgtgcaggcgctgctcgattccatcggcatcccctac
accggctgcggcatggccgcctctgcgctgggtatggacaaataccgctgcaaactgatt
tggcaggcgctcggcctgcccgtacccgatttcgccgtattgcacgatgatactgatttt
gccgctgtggaagccgagctcggcctgccgatgtttgtgaagcccgccgccgaaggcagc
agcgtgggcgtggtgaaagtgaagcagcccggcgagttgccgaaagtgtaccgcgagctg
cgcgaacgccatctgcacggcgaaatcatcgccgaacgctttgtcgacggcggcgaatac
acttgcgccgtgctcggccaacaggcactgcccagcatccgcatcatcccggccaccgag
ttttacgattacgacgccaagtatttccgtgacgatacggtataccaatgccccagcgat
ttggatgcagcgggcgaggccgaaatccgccgcctggccaaagcgggctttgaagccatc
ggcgggcgcggctggggcagggtggatttcctgcgcagccagagcggaaagctttatttg
ttggaaatcaacaccgtgcccggtatgaccagccacagtctggtgccgaaagccgccgcg
caaaccggcttggattttgccgatttatgcgttgaagtattgagccatgcgactttggga
taa

DBGET integrated database retrieval system