KEGG   Eikenella corrodens: SAMEA4412678_2125Help
Entry
SAMEA4412678_2125 CDS       T05039                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ecor  Eikenella corrodens
Pathway
ecor00020  Citrate cycle (TCA cycle)
ecor00310  Lysine degradation
ecor00380  Tryptophan metabolism
ecor01100  Metabolic pathways
ecor01110  Biosynthesis of secondary metabolites
ecor01120  Microbial metabolism in diverse environments
ecor01130  Biosynthesis of antibiotics
ecor01200  Carbon metabolism
Module
ecor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAMEA4412678_2125 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAMEA4412678_2125 (sucA)
   00380 Tryptophan metabolism
    SAMEA4412678_2125 (sucA)
Enzymes [BR:ecor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SAMEA4412678_2125 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: SNW10719
LinkDB All DBs
Position
1:2144086..2146902
Genome map
AA seq 938 aa AA seqDB search
MMKEQSSLSYLYGTNVPYIEDLYEAYLSSPDSVDSQWRQYFDQVAAMPGNTPKDVAHRPI
QEAFANLAQQRGGAAAGGVDFAAMQKQVAVLSLISAYRSLGNRAADLNPLDRTHIRQLPE
LDPKTYGLTDADMNTPFHVGTDLSGSPKLPLAEIIRHLKQIYCGPLALEYMHIPDTAERE
WLQARLEANGARPQFDAETKRLILKEITAAETMERYLHTRYVGQKRFSLEGGESTVPALN
HLIRASTEKGVQEIVIGMAHRGRLNVLVNTMGKAPQAIFDEFEGKVDAKFPSGDVKYHMG
FSSDVPTPHGPVHLSLAYNPSHLEITNPVIEGSVRARQDHRGAEGRKQVLPILTHGDSAF
IGLGVNQSTFNMSQTRGYSTGGTIHFVINNQVGFTTSDPRDTRSILYCTDIAKMVSAPIL
HVNGDDPEAVCHAAQIALDYRTTFQKDIVIDLVCYRKLGHNEGDDPTLTQPLMYKQVAAH
PGSRAVYAEQLIKEGVVTKEEAEKLISDYRAAMDKGDRIQEILPEQKREHAVDWSKYQPI
SWRTPVKTALPAAEIKRLTDRFTDIPADVKLHNTVKKIIENRKAMAVGEQAIDWGMAETI
AYASLLEAGHDIRISGEDSGRGTFSHRHAVLHDQNRAERTGGVYIPLQHISEKQGRFNVI
DSILNEEAVMAYEYGYASSAPEDLVIWEAQFGDFANGAQIAIDQFITSGETKWGRWCGLT
VILPHGYDGQGPEHSSARVERWLQLCAEENIQVLMMSEASQMFHALRRQILRPYRKPLVI
FMSKRLLRLKDACSPLANFTDGEFRLVIGDTVQGRDQDVKRVILCAGQVYYDLAKARADK
GLEKDIAIVRVEQLYPFPYEEVAAELKRFPNATEIMWAQEEPKNQGAWYQIRHRLEKVLG
ANHRLTTASRPASASPAVGYAVKHKAGLDGLLEDAMKL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaacaaagtagtttgtcctacctatacggtaccaacgtcccgtatattgaa
gatttgtacgaagcctatctgagctcccctgactccgtggacagccaatggcggcagtat
ttcgaccaagtggccgccatgcccggcaacactccgaaagatgtggcgcaccgcccgatt
caggaagcctttgccaacttggcacagcagcgcggcggcgcagccgcgggcggcgtggat
tttgccgccatgcagaagcaagtggccgtgttgagcctgatttccgcctaccgctccttg
ggcaaccgcgctgccgacctcaacccgctcgaccgcacccatatcagacaactgcccgag
ctcgatcccaaaacctacggcctcactgatgccgacatgaacacccctttccatgtcggc
accgatctttcaggtagccccaagctgcccctggccgaaatcatccgccatctgaaacaa
atctactgcggccccctggcattggaatacatgcacattcccgacaccgccgaacgcgaa
tggctgcaggcacgtttggaagccaacggcgcccgcccgcagtttgatgccgagactaaa
cgcctcatcctgaaagaaatcaccgccgccgaaaccatggagcgctatctgcacacccgt
tatgtgggccagaaacgcttctcgctcgaaggcggcgaaagcaccgtgcccgcgctgaac
catctgatccgcgcctccaccgaaaaaggtgtgcaggaaatcgtaatcggcatggcgcac
cgcggccgcttaaacgtgttggtaaacaccatgggcaaagccccgcaagccattttcgac
gagttcgaaggcaaagtggacgccaaattccccagcggcgacgtgaaataccacatgggc
ttcagctccgacgtgcccaccccgcacggcccggtgcacctctctttggcctacaacccc
tcacacttggaaatcaccaaccccgtgattgaaggctccgtacgcgcccgccaagaccac
cgcggtgccgaaggccgcaaacaagtgctgcccatcctcacccacggcgactccgccttc
atcggtttgggcgtgaaccaatctactttcaatatgtcgcaaacccgcggctacagcacc
ggcggcaccatccacttcgtgatcaacaaccaagtgggcttcaccacttccgatccgcgc
gacacccgctccatcctgtattgcaccgacatcgccaagatggtgagcgcgccgattctg
catgtgaacggcgacgacccggaagccgtgtgccacgccgcccaaatcgcgctggactac
cgcactaccttccagaaagacatcgtgatcgatttggtgtgctaccgcaaactcggccac
aacgagggcgacgatcccaccctgacccagcctctgatgtacaaacaagtggccgcacac
cccggctcccgcgccgtgtatgccgagcagctgattaaagaaggcgtggtcaccaaggaa
gaagccgaaaaactcatcagcgactaccgcgccgcgatggacaaaggcgaccgcatccag
gaaatcctgcctgagcagaaacgcgaacacgcagtggattggagcaaataccagcccatc
agctggcgcactccggtgaaaactgctctgcctgctgccgaaatcaaacgcctgaccgac
cgcttcaccgacatccccgctgatgtgaaactgcacaataccgtgaagaaaatcatcgaa
aaccgcaaagccatggctgttggcgagcaagctattgactggggtatggccgaaaccatc
gcctacgccagcctgctcgaagccggccacgacatccgcatttccggcgaagactccggc
cgcggcaccttctcacaccgccacgccgtgctgcacgaccaaaaccgtgccgaacgcacc
ggcggcgtgtatatcccgctgcaacacatcagcgaaaaacaaggccgcttcaacgtcatc
gattccatcctgaacgaagaagccgtgatggcctacgaatacggctatgcctcctccgca
ccggaagacctggtgatttgggaagcccagttcggcgacttcgccaacggcgcgcaaatc
gccatcgaccaattcatcacctccggcgaaaccaaatggggacgctggtgcggcctcacc
gttatcctgccgcacggctacgacggccaaggcccggaacactcttccgcccgcgtagaa
cgctggctgcaactgtgtgccgaagaaaacatccaagtgctgatgatgtctgaagcatcg
cagatgttccatgccctgcgccgccagattctgcgcccctaccgcaaaccgctggtgatt
ttcatgtccaaacgcctgctgcgcctcaaagacgcctgcagcccactggccaacttcacc
gacggcgaattccgccttgtgatcggcgacaccgtacaaggtcgcgatcaagacgtgaaa
cgcgtgattctgtgtgccggccaggtgtactacgatttggccaaagcccgcgccgacaaa
ggcttggaaaaagacatcgccatcgttcgcgtcgagcagctctaccccttcccctacgaa
gaagtggccgccgaactcaaacgcttcccgaacgccaccgaaatcatgtgggcacaggaa
gagccgaaaaaccaaggcgcttggtaccaaatccgccaccgtctggaaaaagtgctcggc
gccaaccatcgcctcaccaccgccagccgcccggccagcgcctcgcccgccgtcggctat
gctgtgaaacacaaagccggtttggacggcctgcttgaagacgcgatgaaactctaa

DBGET integrated database retrieval system