KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_0132Help
Entry
EC958_0132        CDS       T04373                                 

Gene name
arcA
Definition
(GenBank) ArcA transcriptional dual regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos02020  Two-component system
ecos02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC958_0132 (arcA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    EC958_0132 (arcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecos02022]
    EC958_0132 (arcA)
Two-component system [BR:ecos02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   EC958_0132 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CDN85349
UniProt: W9A0W3
LinkDB All DBs
Structure
PDB: 

Position
complement(5107705..5108421)
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttatcgttgaagacgagttggtaacacgcaacacgttgaaa
agtattttcgaagcggaaggctatgatgttttcgaagcgacagatggcgcggaaatgcat
cagatcctctctgaatatgacatcaacctggtgatcatggatatcaatctgccgggtaag
aacggtcttctgttagcgcgtgaactgcgcgagcaggcgaatgttgcgttgatgttcctg
actggccgtgacaacgaagtcgataaaattctcggcctcgaaatcggtgcagatgactac
atcaccaaaccgttcaacccgcgtgaactgactattcgtgcacgcaacctgctgtcccgt
accatgaatctgggtactgtcagcgaagaacgtcgtagcgttgaaagctacaagttcaat
ggttgggaactggacatcaacagccgttcgttgatcggccctgatggcgagcagtacaag
ctgccgcgcagcgagttccgcgccatgcttcacttctgtgaaaacccaggtaaaattcag
tcccgtgctgaactgctgaagaaaatgaccggccgtgagctgaaaccgcacgaccgtact
gtagacgtgacgatccgccgtattcgtaaacatttcgaatctacgccggatacgccggaa
atcatcgccaccattcacggtgaaggttatcgcttctgcggtgatctggaagattaa

DBGET integrated database retrieval system