KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_1781Help
Entry
EC958_1781        CDS       T04373                                 

Gene name
yneI
Definition
(GenBank) aldehyde-dehydrogenase like protein YneI
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00250  Alanine, aspartate and glutamate metabolism
ecos00650  Butanoate metabolism
ecos00760  Nicotinate and nicotinamide metabolism
ecos01100  Metabolic pathways
ecos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EC958_1781 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC958_1781 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EC958_1781 (yneI)
Enzymes [BR:ecos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     EC958_1781 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     EC958_1781 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: CDN82061
UniProt: W8ZRI9
LinkDB All DBs
Position
complement(1702471..1703883)
Genome map
AA seq 470 aa AA seqDB search
MTHKGDTPMTITPATHAISINPATGEQLSVLPWAGVDDIENALQLAAAGFRDWRETNIDY
RAEKLRDIGKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEP
TLVENQQAVIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLV
AQVFKDAGIPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCV
LELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAA
AALKMGDPRDEDNALGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVL
ANVTPEMTAFREEMFGPVAAITIAKDAEHALELANDSEFGLSATIFTTDETQARQMAARL
ECGGVFINGYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaggagataccccgatgaccattactccggcaactcatgcaatttcgata
aatcctgccaccggtgaacaactttctgtgctgccgtgggctggtgttgacgatatcgaa
aacgcacttcagctggcggcagcaggctttcgcgactggcgcgagacaaatatagattat
cgtgctgaaaaactgcgtgatatcggtaaggctctgcgcgcccgtagcgaagaaatggcg
caaatgatcacccgtgaaatgggcaaaccaatcaaccaggcgcgcgctgaagtggcgaaa
tcggcgaatttgtgtgactggtatgcagaacatggtccggcaatgctgaaggcagaacct
acgctggtggaaaatcagcaggcggttattgagtatcgaccgttggggacgattctggcg
attatgccgtggaattttccgttatggcaggtgatgcgtggcgctgttcccatcattctt
gctggtaacggctacttacttaaacatgcgccgaatgtgatgggctgtgcacagctcgtt
gcccaggtgtttaaagatgcgggtatcccacaaggcgtatatggctggctgaatgccgac
aacgacggtgtcagtcagatgattaaagattcgcgcattgctgctgtcacagtgaccgga
agtgttcgtgctggagcggctattggcgcacaggctggagcggcactgaaaaaatgcgta
ctggaactgggtggttcggatccgtttattgtgcttaacgatgccgatctggaactggcg
gtgaaagcggcggtagccggacgttatcagaataccggacaggtttgtgcagcggcaaaa
cgctttatcatcgaagagggaattgcttcggcatttaccgaacgttttgtggcagctgcg
gcagccttgaaaatgggcgatccccgtgatgaagacaacgctctcggaccaatggctcgt
tttgatttacgtgatgagctgcatcatcaggtggaaaaaacactggcgcagggtgcgcgt
ttgttactgggcggggaaaagatggctggggcaggtaactactatccgccaacggttctg
gcgaatgttaccccagaaatgaccgcgtttcgggaagaaatgtttggccccgttgcggca
atcaccattgcgaaagatgcagaacatgcgctggaactggctaatgatagtgagttcggc
ctttcagcgaccattttcaccaccgacgaaacacaggccagacagatggcggcacgtctg
gaatgcggtggggtgtttatcaatggttattgtgccagcgatgcgcgagtcgcctttggt
ggcgtgaagaagagtggctttggtcgtgagctttcccatttcggcttacacgaattctgt
aatatccagacggtgtggaaagaccgggtctga

DBGET integrated database retrieval system