KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_2498Help
Entry
EC958_2498        CDS       T04373                                 

Gene name
yeiK
Definition
(GenBank) hypothetical protein
  KO
K10213  ribosylpyrimidine nucleosidase [EC:3.2.2.8]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00230  Purine metabolism
ecos00240  Pyrimidine metabolism
ecos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC958_2498 (yeiK)
   00240 Pyrimidine metabolism
    EC958_2498 (yeiK)
Enzymes [BR:ecos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.8  ribosylpyrimidine nucleosidase
     EC958_2498 (yeiK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: CDN82840
UniProt: W9AHN8
LinkDB All DBs
Structure
PDB: 

Position
complement(2454905..2455846)
Genome map
AA seq 313 aa AA seqDB search
MEKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAENTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagaaaaattattctggattgtgatccgggtcatgatgatgctattgctata
atgatggcggcgaaacatcctgcgattgatttattaggtatcaccattgtagcgggtaat
caaaccctcgataaaacattaattaatggcctgaatgtttgccagaaactggagattaat
gttccggtttatgcggggatgccgcagcccattatgcgtcaacaaattgttgccgataat
attcacggtgaaaccggactggatggcccggtattcgagccgctgacccgccaggcagaa
aacactcatgcggtgaaatatatcatcgatacccttatggcaagcgatggcgatatcact
ctggtgccggttggtccgttgtcaaacatcgcggtggcaatgcgtatgcaacccgcgatc
ctgccgaaaatccgtgaaattgttctgatgggcggcgcttatggtactggcaacttcacc
ccatctgctgagttcaatatctttgctgacccggaagccgcacgcgtggtgttcacctcc
ggcgttccattagtgatgatgggcctcgatcttaccaaccagaccgtttgcaccccggac
gtgattgctcggatggaaagggctggcggccctgcgggagagctgttcagcgacatcatg
aacttcactctcaaaacgcagttcgaaaactacggcctggctggcggcccggtgcacgac
gccacctgcatcggttatttgattaaccctgatggcattaaaacccaggagatgtacgtc
gaagtggacgttaacagtggcccttgctatgggcgtaccgtctgcgacgagttgggcgtt
cttggcaagcccgccaataccaaagtcggcatcactattgatacagactggttctgggga
ttagtcgaagagtgcgtacgcggctacatcaaaacccattaa

DBGET integrated database retrieval system