KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_2596Help
Entry
EC958_2596        CDS       T04373                                 

Definition
(GenBank) hypothetical protein
  KO
K12962  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EC958_2596
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecos01005]
    EC958_2596
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecos02000]
    EC958_2596
Lipopolysaccharide biosynthesis proteins [BR:ecos01005]
 Unusual sugar
  EC958_2596
Transporters [BR:ecos02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   EC958_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Multi_Drug_Res TMEM234 DUF202 Pox_A14
Motif
Other DBs
NCBI-ProteinID: CDN82937
UniProt: W8ZU11
LinkDB All DBs
Position
2569417..2569752
Genome map
AA seq 111 aa AA seqDB search
MIWLTLVFASLLSVAGQLCQKQATCFAAVNKRRKHIVLWLGLALACLGLAMVLWLLVLQN
VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSLRHWCGVAFIIGGIVILGSTV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatctggctaacattagtctttgccagcttgcttagcgttgccgggcagttgtgtcag
aaacaggcaacctgctttgcggcggtaaacaaacggcgcaaacatatcgtgctgtggctg
ggactggcgctggcttgtcttggccttgccatggtgctctggctgctggtcttgcagaac
gtaccggtaggcattgcctacccgatgttaagtctgaattttgtctgggtaacgctggct
gcagtaaaactgtggcacgagccggtatcgctgcgtcactggtgtggggtggcgttcatt
attggcggcattgtgatcctcgggagtacggtgtaa

DBGET integrated database retrieval system