KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_2625Help
Entry
EC958_2625        CDS       T04373                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00220  Arginine biosynthesis
ecos00250  Alanine, aspartate and glutamate metabolism
ecos00290  Valine, leucine and isoleucine biosynthesis
ecos01100  Metabolic pathways
ecos01110  Biosynthesis of secondary metabolites
ecos01130  Biosynthesis of antibiotics
ecos01210  2-Oxocarboxylic acid metabolism
ecos01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC958_2625
   00290 Valine, leucine and isoleucine biosynthesis
    EC958_2625
   00220 Arginine biosynthesis
    EC958_2625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecos01007]
    EC958_2625
Enzymes [BR:ecos01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EC958_2625
    2.6.1.66  valine---pyruvate transaminase
     EC958_2625
Amino acid related enzymes [BR:ecos01007]
 Aminotransferase (transaminase)
  Class I
   EC958_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CDN82967
UniProt: W8ZU38
LinkDB All DBs
Structure
PDB: 

Position
2600542..2601759
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaattctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaagcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcactctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatctttgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactccattgcgccgcttgcacctgacctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gctaaaggttacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcactgggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaattgatcaacgatatt
ccgggcgtttcctgcgtgaaacctcgtggtgcgctgtatatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gtcctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagtaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system