KEGG   Escherichia coli O25b K100 H4-ST131 EC958 (UPEC): EC958_2926Help
Entry
EC958_2926        CDS       T04373                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecos  Escherichia coli O25b:K100:H4-ST131 EC958 (UPEC)
Pathway
ecos00250  Alanine, aspartate and glutamate metabolism
ecos00280  Valine, leucine and isoleucine degradation
ecos00410  beta-Alanine metabolism
ecos00640  Propanoate metabolism
ecos00650  Butanoate metabolism
ecos01100  Metabolic pathways
ecos01120  Microbial metabolism in diverse environments
Module
ecos_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EC958_2926 (gabT)
   00650 Butanoate metabolism
    EC958_2926 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC958_2926 (gabT)
   00280 Valine, leucine and isoleucine degradation
    EC958_2926 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC958_2926 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecos01007]
    EC958_2926 (gabT)
Enzymes [BR:ecos01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EC958_2926 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EC958_2926 (gabT)
Amino acid related enzymes [BR:ecos01007]
 Aminotransferase (transaminase)
  Class III
   EC958_2926 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CDN83262
UniProt: W8ZV04
LinkDB All DBs
Structure
PDB: 

Position
2931680..2932966
Genome map
AA seq 428 aa AA seqDB search
MRMISNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIE
LFEDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgatcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcaattgaaaaaactgtcgcacacctgcttc
caggtgctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtat
cacgggcgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaa
aatctgctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgata
gccgaaaaacacccggagatcggcgacgtacgcggtctgggggcgatgatcgccatcgag
ctgtttgaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggca
cgcgcccgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagc
cagtgttttgctgaggcgaagctgtag

DBGET integrated database retrieval system